Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Decaprenyl-diphosphate synthase subunit 1

Gene

PDSS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10.1 Publication

Catalytic activityi

(2E,6E)-farnesyl diphosphate + 7 isopentenyl diphosphate = 7 diphosphate + all-trans-decaprenyl diphosphate.1 Publication

Cofactori

Mg2+By similarityNote: Binds 3 Mg2+ ions per subunit.By similarity

Pathwayi: ubiquinone biosynthesis

This protein is involved in the pathway ubiquinone biosynthesis, which is part of Cofactor biosynthesis.
View all proteins of this organism that are known to be involved in the pathway ubiquinone biosynthesis and in Cofactor biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei134Isopentenyl diphosphateBy similarity1
Binding sitei137Isopentenyl diphosphateBy similarity1
Binding sitei173Isopentenyl diphosphateBy similarity1
Metal bindingi180Magnesium 1By similarity1
Metal bindingi180Magnesium 2By similarity1
Metal bindingi184Magnesium 1By similarity1
Metal bindingi184Magnesium 2By similarity1
Binding sitei189Polyprenyl diphosphateBy similarity1
Binding sitei190Isopentenyl diphosphateBy similarity1
Binding sitei266Polyprenyl diphosphateBy similarity1
Binding sitei267Polyprenyl diphosphateBy similarity1
Binding sitei304Polyprenyl diphosphateBy similarity1
Metal bindingi307Magnesium 3By similarity1
Binding sitei321Polyprenyl diphosphateBy similarity1

GO - Molecular functioni

GO - Biological processi

  • isoprenoid biosynthetic process Source: HGNC
  • protein heterotetramerization Source: Ensembl
  • ubiquinone biosynthetic process Source: HGNC

Keywordsi

Molecular functionTransferase
Biological processIsoprene biosynthesis, Ubiquinone biosynthesis
LigandMagnesium, Metal-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS07530-MONOMER
BRENDAi2.5.1.91 2681
ReactomeiR-HSA-2142789 Ubiquinol biosynthesis
UniPathwayiUPA00232

Names & Taxonomyi

Protein namesi
Recommended name:
Decaprenyl-diphosphate synthase subunit 1 (EC:2.5.1.91)
Alternative name(s):
All-trans-decaprenyl-diphosphate synthase subunit 1
Decaprenyl pyrophosphate synthase subunit 1
Trans-prenyltransferase 1
Short name:
TPT 1
Gene namesi
Name:PDSS1
Synonyms:DPS1, TPRT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000148459.15
HGNCiHGNC:17759 PDSS1
MIMi607429 gene
neXtProtiNX_Q5T2R2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Involvement in diseasei

Coenzyme Q10 deficiency, primary, 2 (COQ10D2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive multisystem disorder characterized by early-onset deafness, optic atrophy, mild mental retardation, peripheral neuropathy, obesity, livedo reticularis, and cardiac valvulopathy.
See also OMIM:614651
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034879308D → E in COQ10D2. 1 PublicationCorresponds to variant dbSNP:rs119463988EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Primary mitochondrial disease

Organism-specific databases

DisGeNETi23590
MalaCardsiPDSS1
MIMi614651 phenotype
OpenTargetsiENSG00000148459
Orphaneti254898 Deafness - encephaloneuropathy - obesity - valvulopathy
PharmGKBiPA134982512

Polymorphism and mutation databases

BioMutaiPDSS1
DMDMi74744657

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001239751 – 415Decaprenyl-diphosphate synthase subunit 1Add BLAST415

Proteomic databases

EPDiQ5T2R2
MaxQBiQ5T2R2
PaxDbiQ5T2R2
PeptideAtlasiQ5T2R2
PRIDEiQ5T2R2
ProteomicsDBi64353
64354 [Q5T2R2-2]
64355 [Q5T2R2-3]

PTM databases

iPTMnetiQ5T2R2
PhosphoSitePlusiQ5T2R2

Expressioni

Gene expression databases

BgeeiENSG00000148459
CleanExiHS_PDSS1
ExpressionAtlasiQ5T2R2 baseline and differential
GenevisibleiQ5T2R2 HS

Organism-specific databases

HPAiHPA038032
HPA042741

Interactioni

Subunit structurei

Heterotetramer of 2 DPS1/TPRT and 2 DLP1 subunits.1 Publication

GO - Molecular functioni

  • protein heterodimerization activity Source: HGNC

Protein-protein interaction databases

BioGridi117125, 11 interactors
IntActiQ5T2R2, 2 interactors
MINTiQ5T2R2
STRINGi9606.ENSP00000365388

Structurei

3D structure databases

ProteinModelPortaliQ5T2R2
SMRiQ5T2R2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FPP/GGPP synthase family.Curated

Phylogenomic databases

eggNOGiKOG0776 Eukaryota
COG0142 LUCA
GeneTreeiENSGT00530000063378
HOGENOMiHOG000009104
HOVERGENiHBG054389
InParanoidiQ5T2R2
KOiK12504
OMAiGKQMRPM
OrthoDBiEOG091G1BWC
PhylomeDBiQ5T2R2
TreeFamiTF313548

Family and domain databases

Gene3Di1.10.600.10, 1 hit
InterProiView protein in InterPro
IPR008949 Isoprenoid_synthase_dom_sf
IPR000092 Polyprenyl_synt
IPR033749 Polyprenyl_synt_CS
PfamiView protein in Pfam
PF00348 polyprenyl_synt, 1 hit
SUPFAMiSSF48576 SSF48576, 1 hit
PROSITEiView protein in PROSITE
PS00723 POLYPRENYL_SYNTHASE_1, 1 hit
PS00444 POLYPRENYL_SYNTHASE_2, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5T2R2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASRWWRWRR GCSWKPAARS PGPGSPGRAG PLGPSAAAEV RAQVHRRKGL
60 70 80 90 100
DLSQIPYINL VKHLTSACPN VCRISRFHHT TPDSKTHSGE KYTDPFKLGW
110 120 130 140 150
RDLKGLYEDI RKELLISTSE LKEMSEYYFD GKGKAFRPII VALMARACNI
160 170 180 190 200
HHNNSRHVQA SQRAIALIAE MIHTASLVHD DVIDDASSRR GKHTVNKIWG
210 220 230 240 250
EKKAVLAGDL ILSAASIALA RIGNTTVISI LTQVIEDLVR GEFLQLGSKE
260 270 280 290 300
NENERFAHYL EKTFKKTASL IANSCKAVSV LGCPDPVVHE IAYQYGKNVG
310 320 330 340 350
IAFQLIDDVL DFTSCSDQMG KPTSADLKLG LATGPVLFAC QQFPEMNAMI
360 370 380 390 400
MRRFSLPGDV DRARQYVLQS DGVQQTTYLA QQYCHEAIRE ISKLRPSPER
410
DALIQLSEIV LTRDK
Length:415
Mass (Da):46,261
Last modified:December 21, 2004 - v1
Checksum:iF0B073C75CBD06D2
GO
Isoform 2 (identifier: Q5T2R2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-415: SVLGCPDPVV...LSEIVLTRDK → FPRNECYDHATVQFAWRCRQSSTVCTTE

Note: No experimental confirmation available.
Show »
Length:306
Mass (Da):34,304
Checksum:iD5195700E8AFF902
GO
Isoform 3 (identifier: Q5T2R2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MASRWWRWRRGCSWKPAARSPGPGSPGRAGPLGPSAAAEVRA → MPA

Show »
Length:376
Mass (Da):42,089
Checksum:iBB32C9961B92ED00
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti30G → V in AAH63635 (PubMed:15489334).Curated1
Sequence conflicti44V → A in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti47R → Q in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti58I → F in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti66S → P in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti72 – 73CR → YS in AAD28559 (PubMed:10972372).Curated2
Sequence conflicti76R → Q in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti83D → Y in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti109D → G in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti114L → P in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti119S → T in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti124M → I in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti131G → V in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti142A → V in AAD28559 (PubMed:10972372).Curated1
Sequence conflicti186A → V in BAD97134 (Ref. 3) Curated1
Sequence conflicti298N → D in BAD97134 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034879308D → E in COQ10D2. 1 PublicationCorresponds to variant dbSNP:rs119463988EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0171001 – 42MASRW…AEVRA → MPA in isoform 3. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_017101279 – 415SVLGC…LTRDK → FPRNECYDHATVQFAWRCRQ SSTVCTTE in isoform 2. 1 PublicationAdd BLAST137

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF118395 mRNA Translation: AAD28559.1
AB210838 mRNA Translation: BAE48216.1
AK223414 mRNA Translation: BAD97134.1
AL390961 Genomic DNA No translation available.
BC049211 mRNA Translation: AAH49211.1
BC063635 mRNA Translation: AAH63635.1
CCDSiCCDS31168.1 [Q5T2R2-1]
RefSeqiNP_001308907.1, NM_001321978.1 [Q5T2R2-2]
NP_055132.2, NM_014317.4 [Q5T2R2-1]
UniGeneiHs.558468

Genome annotation databases

EnsembliENST00000376215; ENSP00000365388; ENSG00000148459 [Q5T2R2-1]
GeneIDi23590
KEGGihsa:23590
UCSCiuc001isv.4 human [Q5T2R2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDPS1_HUMAN
AccessioniPrimary (citable) accession number: Q5T2R2
Secondary accession number(s): Q53F75
, Q6P473, Q86WQ8, Q9Y2W5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2006
Last sequence update: December 21, 2004
Last modified: June 20, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health