Q5T292 (CJ128_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 47.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative uncharacterized protein C10orf128 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 105 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5T292-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5T292-2) The sequence of this isoform differs from the canonical sequence as follows: 91-105: RNHNFSKRDAQVIEL → AHVLRDGPAL...KVKSFPKYAY | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q5T292-3) The sequence of this isoform differs from the canonical sequence as follows: 91-105: RNHNFSKRDAQVIEL → AHVLRDGPAL...KVSCKSDHLS | ||||||
| Isoform 4 (identifier: Q5T292-4) The sequence of this isoform differs from the canonical sequence as follows: 91-105: RNHNFSKRDAQVIEL → KLQASTLFSFKSLLQCHHCIMEGLFKAKPQFLQKRCTGD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | Potential | ||||||
| Chain | 20 – 105 | 86 | Putative uncharacterized protein C10orf128 | PRO_0000307322 | |||||
Regions | |||||||||
| Topological domain | 20 – 38 | 19 | Extracellular Potential | ||||||
| Transmembrane | 39 – 59 | 21 | Helical; Potential | ||||||
| Topological domain | 60 – 105 | 46 | Cytoplasmic Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 91 – 105 | 15 | RNHNF…QVIEL → AHVLRDGPALGPLHLLFSVI GMLFARKLQASTLFSFKSLL QCHHCIMEGLFKAKPQFLQK HLARSVQIHQLQKVKSFPKY AY in isoform 2. | VSP_028715 | |||||
| Alternative sequence | 91 – 105 | 15 | RNHNF…QVIEL → AHVLRDGPALGPLHLLFSVI GMLFARKLQASTLFSFKSLL QCHHCIMEGLFKAKPQFLQK VSCKSDHLS in isoform 3. | VSP_028716 | |||||
| Alternative sequence | 91 – 105 | 15 | RNHNF…QVIEL → KLQASTLFSFKSLLQCHHCI MEGLFKAKPQFLQKRCTGD in isoform 4. | VSP_028717 | |||||
| Natural variant | 83 | 1 | P → L. Corresponds to variant rs12257132 [ dbSNP | Ensembl ]. | VAR_035409 | |||||
Experimental info | |||||||||
| Sequence conflict | 16 | 1 | V → A in BI544323. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A computer system platform used to predict novel genes." Yu Z., Zheng Z., Tang T., Fu Y. Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "Full-length cDNA libraries and normalization." Li W.B., Gruber C., Jessee J., Polayes D. Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Neuroblastoma. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Hippocampus. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | DQ884399 mRNA. Translation: ABI63366.1. AL524299 mRNA. No translation available. AL441885, AC084727 Genomic DNA. Translation: CAI12987.1. AL441885, AC084727 Genomic DNA. Translation: CAI12988.1. AL441885, AC084727 Genomic DNA. Translation: CAI12990.1. CH471187 Genomic DNA. Translation: EAW93107.1. CH471187 Genomic DNA. Translation: EAW93108.1. CH471187 Genomic DNA. Translation: EAW93110.1. BC104438 mRNA. No translation available. BC104439 mRNA. No translation available. BI544323 mRNA. No translation available. |
| IPI | IPI00456030. IPI00513963. IPI00514406. IPI00869108. |
| RefSeq | NP_001010863.1. NM_001010863.1. |
| UniGene | Hs.385493. |
3D structure databases | |
| ProteinModelPortal | Q5T292. |
| ModBase | Search... |
Polymorphism databases | |
| DMDM | 74744592. |
Proteomic databases | |
| PRIDE | Q5T292. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000474718; ENSP00000417246; ENSG00000204161. |
| GeneID | 170371. |
| KEGG | hsa:170371. |
| UCSC | uc001jhm.2. human. uc001jhn.2. human. uc001jho.2. human. uc009xoc.1. human. |
Organism-specific databases | |
| CTD | 170371. |
| GeneCards | GC10M050362. |
| HGNC | HGNC:27274. C10orf128. |
| HPA | HPA036719. |
| neXtProt | NX_Q5T292. |
| PharmGKB | PA134962893. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000000409. |
Gene expression databases | |
| ArrayExpress | Q5T292. |
| Bgee | Q5T292. |
| CleanEx | HS_C10orf128. |
| Genevestigator | Q5T292. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 88891. |
Entry information
| Entry name | CJ128_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5T292 Secondary accession number(s): A6XND2, Q5T289, Q5T291 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with