Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative uncharacterized protein C10orf128

Gene

C10orf128

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Protein inferred from homologyi

Names & Taxonomyi

Protein namesi
Recommended name:
Putative uncharacterized protein C10orf128
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:27274. C10orf128.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 3819ExtracellularSequence analysisAdd
BLAST
Transmembranei39 – 5921HelicalSequence analysisAdd
BLAST
Topological domaini60 – 10546CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134962893.

Polymorphism and mutation databases

DMDMi74744592.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence analysisAdd
BLAST
Chaini20 – 10586Putative uncharacterized protein C10orf128PRO_0000307322Add
BLAST

Proteomic databases

PaxDbiQ5T292.
PRIDEiQ5T292.

PTM databases

iPTMnetiQ5T292.
PhosphoSiteiQ5T292.

Expressioni

Gene expression databases

BgeeiQ5T292.
CleanExiHS_C10orf128.
ExpressionAtlasiQ5T292. baseline and differential.
GenevisibleiQ5T292. HS.

Organism-specific databases

HPAiHPA036719.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000417246.

Structurei

3D structure databases

ProteinModelPortaliQ5T292.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J40J. Eukaryota.
ENOG4111805. LUCA.
GeneTreeiENSGT00390000000409.
HOGENOMiHOG000111715.
InParanoidiQ5T292.
PhylomeDBiQ5T292.
TreeFamiTF354108.

Family and domain databases

InterProiIPR029395. DUF4514.
[Graphical view]
PfamiPF14986. DUF4514. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5T292-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNLGVSMLRI LFLLDVGGAQ VLATGKTPGA EIDFKYALIG TAVGVAISAG
60 70 80 90 100
FLALKICMIR RHLFDDDSSD LKSTPGGLSD TIPLKKRAPR RNHNFSKRDA

QVIEL
Length:105
Mass (Da):11,325
Last modified:December 21, 2004 - v1
Checksum:i31E0A590BAB765A7
GO
Isoform 2 (identifier: Q5T292-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-105: RNHNFSKRDAQVIEL → AHVLRDGPAL...KVKSFPKYAY

Note: No experimental confirmation available.
Show »
Length:172
Mass (Da):18,857
Checksum:iF209505109808CE4
GO
Isoform 3 (identifier: Q5T292-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-105: RNHNFSKRDAQVIEL → AHVLRDGPAL...KVSCKSDHLS

Show »
Length:159
Mass (Da):17,190
Checksum:iB479ECDDB58BE17D
GO
Isoform 4 (identifier: Q5T292-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-105: RNHNFSKRDAQVIEL → KLQASTLFSFKSLLQCHHCIMEGLFKAKPQFLQKRCTGD

Show »
Length:129
Mass (Da):13,983
Checksum:i10690E2878F71A77
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti16 – 161V → A in BI544323 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti83 – 831P → L.
Corresponds to variant rs12257132 [ dbSNP | Ensembl ].
VAR_035409

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei91 – 10515RNHNF…QVIEL → AHVLRDGPALGPLHLLFSVI GMLFARKLQASTLFSFKSLL QCHHCIMEGLFKAKPQFLQK HLARSVQIHQLQKVKSFPKY AY in isoform 2. 1 PublicationVSP_028715Add
BLAST
Alternative sequencei91 – 10515RNHNF…QVIEL → AHVLRDGPALGPLHLLFSVI GMLFARKLQASTLFSFKSLL QCHHCIMEGLFKAKPQFLQK VSCKSDHLS in isoform 3. 1 PublicationVSP_028716Add
BLAST
Alternative sequencei91 – 10515RNHNF…QVIEL → KLQASTLFSFKSLLQCHHCI MEGLFKAKPQFLQKRCTGD in isoform 4. 1 PublicationVSP_028717Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ884399 mRNA. Translation: ABI63366.1.
AL524299 mRNA. No translation available.
AL441885, AC084727 Genomic DNA. Translation: CAI12987.1.
AL441885, AC084727 Genomic DNA. Translation: CAI12988.1.
AL441885, AC084727 Genomic DNA. Translation: CAI12990.1.
CH471187 Genomic DNA. Translation: EAW93107.1.
CH471187 Genomic DNA. Translation: EAW93108.1.
CH471187 Genomic DNA. Translation: EAW93110.1.
BC104438 mRNA. No translation available.
BC104439 mRNA. No translation available.
BI544323 mRNA. No translation available.
CCDSiCCDS41519.1. [Q5T292-1]
CCDS73128.1. [Q5T292-4]
RefSeqiNP_001010863.1. NM_001010863.2. [Q5T292-1]
NP_001275669.1. NM_001288740.1. [Q5T292-4]
NP_001275672.1. NM_001288743.1. [Q5T292-2]
UniGeneiHs.385493.

Genome annotation databases

EnsembliENST00000374148; ENSP00000363263; ENSG00000204161. [Q5T292-3]
ENST00000374153; ENSP00000363268; ENSG00000204161. [Q5T292-4]
ENST00000474718; ENSP00000417246; ENSG00000204161. [Q5T292-1]
GeneIDi170371.
KEGGihsa:170371.
UCSCiuc001jhn.6. human. [Q5T292-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ884399 mRNA. Translation: ABI63366.1.
AL524299 mRNA. No translation available.
AL441885, AC084727 Genomic DNA. Translation: CAI12987.1.
AL441885, AC084727 Genomic DNA. Translation: CAI12988.1.
AL441885, AC084727 Genomic DNA. Translation: CAI12990.1.
CH471187 Genomic DNA. Translation: EAW93107.1.
CH471187 Genomic DNA. Translation: EAW93108.1.
CH471187 Genomic DNA. Translation: EAW93110.1.
BC104438 mRNA. No translation available.
BC104439 mRNA. No translation available.
BI544323 mRNA. No translation available.
CCDSiCCDS41519.1. [Q5T292-1]
CCDS73128.1. [Q5T292-4]
RefSeqiNP_001010863.1. NM_001010863.2. [Q5T292-1]
NP_001275669.1. NM_001288740.1. [Q5T292-4]
NP_001275672.1. NM_001288743.1. [Q5T292-2]
UniGeneiHs.385493.

3D structure databases

ProteinModelPortaliQ5T292.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000417246.

PTM databases

iPTMnetiQ5T292.
PhosphoSiteiQ5T292.

Polymorphism and mutation databases

DMDMi74744592.

Proteomic databases

PaxDbiQ5T292.
PRIDEiQ5T292.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374148; ENSP00000363263; ENSG00000204161. [Q5T292-3]
ENST00000374153; ENSP00000363268; ENSG00000204161. [Q5T292-4]
ENST00000474718; ENSP00000417246; ENSG00000204161. [Q5T292-1]
GeneIDi170371.
KEGGihsa:170371.
UCSCiuc001jhn.6. human. [Q5T292-1]

Organism-specific databases

CTDi170371.
GeneCardsiC10orf128.
HGNCiHGNC:27274. C10orf128.
HPAiHPA036719.
neXtProtiNX_Q5T292.
PharmGKBiPA134962893.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J40J. Eukaryota.
ENOG4111805. LUCA.
GeneTreeiENSGT00390000000409.
HOGENOMiHOG000111715.
InParanoidiQ5T292.
PhylomeDBiQ5T292.
TreeFamiTF354108.

Miscellaneous databases

GenomeRNAii170371.
PROiQ5T292.

Gene expression databases

BgeeiQ5T292.
CleanExiHS_C10orf128.
ExpressionAtlasiQ5T292. baseline and differential.
GenevisibleiQ5T292. HS.

Family and domain databases

InterProiIPR029395. DUF4514.
[Graphical view]
PfamiPF14986. DUF4514. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A computer system platform used to predict novel genes."
    Yu Z., Zheng Z., Tang T., Fu Y.
    Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "Full-length cDNA libraries and normalization."
    Li W.B., Gruber C., Jessee J., Polayes D.
    Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Neuroblastoma.
  3. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Hippocampus.

Entry informationi

Entry nameiCJ128_HUMAN
AccessioniPrimary (citable) accession number: Q5T292
Secondary accession number(s): A6XND2, Q5T289, Q5T291
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: December 21, 2004
Last modified: June 8, 2016
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.