Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Testis-expressed sequence 35 protein

Gene

Tex35

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:G66-31416-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Testis-expressed sequence 35 protein
Gene namesi
Name:Tex35
Synonyms:C1orf49
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:25366. TEX35.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi84066.
OpenTargetsiENSG00000240021.
PharmGKBiPA134904440.

Polymorphism and mutation databases

BioMutaiTex35.
DMDMi74744310.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002511871 – 233Testis-expressed sequence 35 proteinAdd BLAST233

Proteomic databases

PaxDbiQ5T0J7.
PeptideAtlasiQ5T0J7.
PRIDEiQ5T0J7.

PTM databases

iPTMnetiQ5T0J7.
PhosphoSitePlusiQ5T0J7.

Expressioni

Tissue specificityi

Testis-specific.1 Publication

Gene expression databases

BgeeiENSG00000240021.
CleanExiHS_C1orf49.
ExpressionAtlasiQ5T0J7. baseline and differential.
GenevisibleiQ5T0J7. HS.

Organism-specific databases

HPAiHPA039190.
HPA041719.

Interactioni

Protein-protein interaction databases

BioGridi123861. 28 interactors.
IntActiQ5T0J7. 4 interactors.
MINTiMINT-4725644.
STRINGi9606.ENSP00000323795.

Structurei

3D structure databases

ProteinModelPortaliQ5T0J7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili45 – 111Sequence analysisAdd BLAST67

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IZ1Y. Eukaryota.
ENOG411197W. LUCA.
GeneTreeiENSGT00390000011962.
HOGENOMiHOG000111219.
HOVERGENiHBG058182.
InParanoidiQ5T0J7.
OMAiQIKDVMD.
OrthoDBiEOG091G0VGU.
PhylomeDBiQ5T0J7.
TreeFamiTF337831.

Family and domain databases

InterProiIPR027874. Tex35.
[Graphical view]
PfamiPF15079. Tsc35. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5T0J7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAKRAELKK THLSKNYKAV CLELKPEPTK TFDYKAVKQE GRFTKAGVTQ
60 70 80 90 100
DLKNELREVR EELKEKMEEI KQIKDLMDKD FDKLHEFVEI MKEMQKDMDE
110 120 130 140 150
KMDILINTQK NYKLPLRRAP KEQQELRLMG KTHREPQLRP KKMDGASGVN
160 170 180 190 200
GAPCALHKKT MAPQKTKQGS LDPLHHCGTC CEKCLLCALK NNYNRGNIPS
210 220 230
EASGLYKGGE EPVTTQPSVG HAVPAPKSQT EGR
Length:233
Mass (Da):26,518
Last modified:December 21, 2004 - v1
Checksum:i0B8B9168E1809B05
GO
Isoform 2 (identifier: Q5T0J7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     13-13: L → LVKERHCWT
     196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → GIYAAVGLLDLW

Show »
Length:215
Mass (Da):25,014
Checksum:iB34BB92695CB7868
GO
Isoform 3 (identifier: Q5T0J7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-233: EKCLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → VSETLPEPSTGARPLAPAPW

Show »
Length:201
Mass (Da):23,096
Checksum:iB6B7161A1248EF65
GO
Isoform 4 (identifier: Q5T0J7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-76: Missing.
     196-233: GNIPSEASGL...PAPKSQTEGR → AAPLKEARHL...MRDEINSERR

Show »
Length:179
Mass (Da):20,199
Checksum:i28CAC48DF030515F
GO
Isoform 5 (identifier: Q5T0J7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → AQLQNLPAVPIHHLQAP

Show »
Length:212
Mass (Da):24,531
Checksum:iA23C8F537A6CD276
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti14S → C in CAB66629 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02765655E → G.Corresponds to variant rs16852957dbSNPEnsembl.1
Natural variantiVAR_027657146A → G.Corresponds to variant rs12079481dbSNPEnsembl.1
Natural variantiVAR_059592171L → P.Corresponds to variant rs3813636dbSNPEnsembl.1
Natural variantiVAR_027658171L → R.1 PublicationCorresponds to variant rs3813636dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0207371 – 76Missing in isoform 4. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_02073813L → LVKERHCWT in isoform 2. 1 Publication1
Alternative sequenceiVSP_020739182 – 233EKCLL…QTEGR → VSETLPEPSTGARPLAPAPW in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_020740196 – 233GNIPS…QTEGR → GIYAAVGLLDLW in isoform 2. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_020741196 – 233GNIPS…QTEGR → AAPLKEARHLLTANSIDPSA ALVLLIEFLLLTLVTGAAAP GLDACGHQRNMRDEINSERR in isoform 4. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_045739196 – 233GNIPS…QTEGR → AQLQNLPAVPIHHLQAP in isoform 5. CuratedAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136694 mRNA. Translation: CAB66629.1.
AK093269 mRNA. Translation: BAC04115.1.
AK097518 mRNA. Translation: BAC05085.1.
AL513013 Genomic DNA. Translation: CAI23535.1.
AL513013 Genomic DNA. Translation: CAI23536.1.
AL513013 Genomic DNA. Translation: CAI23537.1.
AL513013 Genomic DNA. Translation: CAI23538.1.
BC034972 mRNA. Translation: AAH34972.1.
CCDSiCCDS1323.1. [Q5T0J7-1]
CCDS53433.1. [Q5T0J7-5]
CCDS53434.1. [Q5T0J7-2]
RefSeqiNP_001164193.1. NM_001170722.1. [Q5T0J7-2]
NP_001164194.1. NM_001170723.1. [Q5T0J7-5]
NP_001164195.1. NM_001170724.1.
NP_115502.2. NM_032126.4. [Q5T0J7-1]
UniGeneiHs.534501.

Genome annotation databases

EnsembliENST00000319416; ENSP00000323795; ENSG00000240021. [Q5T0J7-1]
ENST00000367639; ENSP00000356611; ENSG00000240021. [Q5T0J7-2]
ENST00000367641; ENSP00000356613; ENSG00000240021. [Q5T0J7-3]
ENST00000367643; ENSP00000356615; ENSG00000240021. [Q5T0J7-5]
GeneIDi84066.
KEGGihsa:84066.
UCSCiuc001glt.3. human. [Q5T0J7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136694 mRNA. Translation: CAB66629.1.
AK093269 mRNA. Translation: BAC04115.1.
AK097518 mRNA. Translation: BAC05085.1.
AL513013 Genomic DNA. Translation: CAI23535.1.
AL513013 Genomic DNA. Translation: CAI23536.1.
AL513013 Genomic DNA. Translation: CAI23537.1.
AL513013 Genomic DNA. Translation: CAI23538.1.
BC034972 mRNA. Translation: AAH34972.1.
CCDSiCCDS1323.1. [Q5T0J7-1]
CCDS53433.1. [Q5T0J7-5]
CCDS53434.1. [Q5T0J7-2]
RefSeqiNP_001164193.1. NM_001170722.1. [Q5T0J7-2]
NP_001164194.1. NM_001170723.1. [Q5T0J7-5]
NP_001164195.1. NM_001170724.1.
NP_115502.2. NM_032126.4. [Q5T0J7-1]
UniGeneiHs.534501.

3D structure databases

ProteinModelPortaliQ5T0J7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123861. 28 interactors.
IntActiQ5T0J7. 4 interactors.
MINTiMINT-4725644.
STRINGi9606.ENSP00000323795.

PTM databases

iPTMnetiQ5T0J7.
PhosphoSitePlusiQ5T0J7.

Polymorphism and mutation databases

BioMutaiTex35.
DMDMi74744310.

Proteomic databases

PaxDbiQ5T0J7.
PeptideAtlasiQ5T0J7.
PRIDEiQ5T0J7.

Protocols and materials databases

DNASUi84066.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000319416; ENSP00000323795; ENSG00000240021. [Q5T0J7-1]
ENST00000367639; ENSP00000356611; ENSG00000240021. [Q5T0J7-2]
ENST00000367641; ENSP00000356613; ENSG00000240021. [Q5T0J7-3]
ENST00000367643; ENSP00000356615; ENSG00000240021. [Q5T0J7-5]
GeneIDi84066.
KEGGihsa:84066.
UCSCiuc001glt.3. human. [Q5T0J7-1]

Organism-specific databases

CTDi84066.
DisGeNETi84066.
GeneCardsiTEX35.
HGNCiHGNC:25366. TEX35.
HPAiHPA039190.
HPA041719.
neXtProtiNX_Q5T0J7.
OpenTargetsiENSG00000240021.
PharmGKBiPA134904440.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IZ1Y. Eukaryota.
ENOG411197W. LUCA.
GeneTreeiENSGT00390000011962.
HOGENOMiHOG000111219.
HOVERGENiHBG058182.
InParanoidiQ5T0J7.
OMAiQIKDVMD.
OrthoDBiEOG091G0VGU.
PhylomeDBiQ5T0J7.
TreeFamiTF337831.

Enzyme and pathway databases

BioCyciZFISH:G66-31416-MONOMER.

Miscellaneous databases

GeneWikiiC1orf49.
GenomeRNAii84066.
PROiQ5T0J7.

Gene expression databases

BgeeiENSG00000240021.
CleanExiHS_C1orf49.
ExpressionAtlasiQ5T0J7. baseline and differential.
GenevisibleiQ5T0J7. HS.

Family and domain databases

InterProiIPR027874. Tex35.
[Graphical view]
PfamiPF15079. Tsc35. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTEX35_HUMAN
AccessioniPrimary (citable) accession number: Q5T0J7
Secondary accession number(s): Q5T0J8
, Q5T0J9, Q8IYU6, Q8N7Z1, Q8NA15, Q9H0Q7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: December 21, 2004
Last modified: November 2, 2016
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.