Q5T0J7 (TEX35_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 70.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Testis-expressed sequence 35 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 233 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Tissue specificity | Testis-specific. Ref.5 |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | microtubule cytoskeleton Inferred from direct assay. Source: LIFEdb nucleusInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5T0J7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5T0J7-2) The sequence of this isoform differs from the canonical sequence as follows: 13-13: L → LVKERHCWT 196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → GIYAAVGLLDLW | ||||||
| Isoform 3 (identifier: Q5T0J7-3) The sequence of this isoform differs from the canonical sequence as follows: 182-233: EKCLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → VSETLPEPSTGARPLAPAPW | ||||||
| Isoform 4 (identifier: Q5T0J7-4) The sequence of this isoform differs from the canonical sequence as follows: 1-76: Missing. 196-233: GNIPSEASGL...PAPKSQTEGR → AAPLKEARHL...MRDEINSERR | ||||||
| Isoform 5 (identifier: Q5T0J7-5) The sequence of this isoform differs from the canonical sequence as follows: 196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → AQLQNLPAVPIHHLQAP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 233 | 233 | Testis-expressed sequence 35 protein | PRO_0000251187 | |||||
Regions | |||||||||
| Coiled coil | 45 – 111 | 67 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 76 | 76 | Missing in isoform 4. | VSP_020737 | |||||
| Alternative sequence | 13 | 1 | L → LVKERHCWT in isoform 2. | VSP_020738 | |||||
| Alternative sequence | 182 – 233 | 52 | EKCLL…QTEGR → VSETLPEPSTGARPLAPAPW in isoform 3. | VSP_020739 | |||||
| Alternative sequence | 196 – 233 | 38 | GNIPS…QTEGR → GIYAAVGLLDLW in isoform 2. | VSP_020740 | |||||
| Alternative sequence | 196 – 233 | 38 | GNIPS…QTEGR → AAPLKEARHLLTANSIDPSA ALVLLIEFLLLTLVTGAAAP GLDACGHQRNMRDEINSERR in isoform 4. | VSP_020741 | |||||
| Alternative sequence | 196 – 233 | 38 | GNIPS…QTEGR → AQLQNLPAVPIHHLQAP in isoform 5. | VSP_045739 | |||||
| Natural variant | 55 | 1 | E → G. Corresponds to variant rs16852957 [ dbSNP | Ensembl ]. | VAR_027656 | |||||
| Natural variant | 146 | 1 | A → G. Corresponds to variant rs12079481 [ dbSNP | Ensembl ]. | VAR_027657 | |||||
| Natural variant | 171 | 1 | L → P. Corresponds to variant rs3813636 [ dbSNP | Ensembl ]. | VAR_059592 | |||||
| Natural variant | 171 | 1 | L → R. Ref.2 Corresponds to variant rs3813636 [ dbSNP | Ensembl ]. | VAR_027658 | |||||
Experimental info | |||||||||
| Sequence conflict | 14 | 1 | S → C in CAB66629. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Fetal brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT ARG-171. Tissue: Testis. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [5] | "Identification and characteristics of a novel testis-specific gene, Tsc24, in human and mice." Tang A., Yu Z., Gui Y., Guo X., Long Y., Cai Z. Biol. Pharm. Bull. 29:2187-2191(2006) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL136694 mRNA. Translation: CAB66629.1. AK093269 mRNA. Translation: BAC04115.1. AK097518 mRNA. Translation: BAC05085.1. AL513013 Genomic DNA. Translation: CAI23535.1. AL513013 Genomic DNA. Translation: CAI23536.1. AL513013 Genomic DNA. Translation: CAI23537.1. AL513013 Genomic DNA. Translation: CAI23538.1. BC034972 mRNA. Translation: AAH34972.1. |
| IPI | IPI00030237. IPI00217879. IPI00385721. IPI00514942. IPI00844334. |
| RefSeq | NP_001164193.1. NM_001170722.1. NP_001164194.1. NM_001170723.1. NP_001164195.1. NM_001170724.1. NP_115502.2. NM_032126.4. |
| UniGene | Hs.534501. |
3D structure databases | |
| ProteinModelPortal | Q5T0J7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000323795. |
PTM databases | |
| PhosphoSite | Q5T0J7. |
Polymorphism databases | |
| DMDM | 74744310. |
Proteomic databases | |
| PaxDb | Q5T0J7. |
| PRIDE | Q5T0J7. |
Protocols and materials databases | |
| DNASU | 84066. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000258298; ENSP00000258298; ENSG00000240021. ENST00000319416; ENSP00000323795; ENSG00000240021. ENST00000367639; ENSP00000356611; ENSG00000240021. ENST00000367641; ENSP00000356613; ENSG00000240021. ENST00000367643; ENSP00000356615; ENSG00000240021. |
| GeneID | 84066. |
| KEGG | hsa:84066. |
| UCSC | uc001glt.2. human. uc001glu.1. human. uc001glw.2. human. |
Organism-specific databases | |
| CTD | 84066. |
| GeneCards | GC01P178484. |
| HGNC | HGNC:25366. TEX35. |
| HPA | HPA039190. HPA041719. |
| neXtProt | NX_Q5T0J7. |
| PharmGKB | PA134904440. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG39358. |
| HOGENOM | HOG000111219. |
| HOVERGEN | HBG058182. |
| InParanoid | Q5T0J7. |
| OMA | VLINIQK. |
| OrthoDB | EOG4TXBSW. |
| PhylomeDB | Q5T0J7. |
Gene expression databases | |
| ArrayExpress | Q5T0J7. |
| Bgee | Q5T0J7. |
| CleanEx | HS_C1orf49. |
| Genevestigator | Q5T0J7. |
| GermOnline | ENSG00000184909. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 84066. |
| NextBio | 73243. |
Entry information
| Entry name | TEX35_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5T0J7 Secondary accession number(s): Q5T0J8 Q9H0Q7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with
