Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5T0J7

- TEX35_HUMAN

UniProt

Q5T0J7 - TEX35_HUMAN

Protein

Testis-expressed sequence 35 protein

Gene

Tex35

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 80 (01 Oct 2014)
      Sequence version 1 (21 Dec 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Testis-expressed sequence 35 protein
    Gene namesi
    Name:Tex35
    Synonyms:C1orf49
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:25366. TEX35.

    Subcellular locationi

    GO - Cellular componenti

    1. microtubule cytoskeleton Source: LIFEdb
    2. nucleus Source: UniProtKB

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134904440.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 233233Testis-expressed sequence 35 proteinPRO_0000251187Add
    BLAST

    Proteomic databases

    PaxDbiQ5T0J7.
    PRIDEiQ5T0J7.

    PTM databases

    PhosphoSiteiQ5T0J7.

    Expressioni

    Tissue specificityi

    Testis-specific.1 Publication

    Gene expression databases

    ArrayExpressiQ5T0J7.
    BgeeiQ5T0J7.
    CleanExiHS_C1orf49.
    GenevestigatoriQ5T0J7.

    Organism-specific databases

    HPAiHPA039190.
    HPA041719.

    Interactioni

    Protein-protein interaction databases

    BioGridi123861. 4 interactions.
    IntActiQ5T0J7. 3 interactions.
    MINTiMINT-4725644.
    STRINGi9606.ENSP00000323795.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5T0J7.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili45 – 11167Sequence AnalysisAdd
    BLAST

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG39358.
    HOGENOMiHOG000111219.
    HOVERGENiHBG058182.
    InParanoidiQ5T0J7.
    OMAiPLDSLHQ.
    OrthoDBiEOG74XS84.
    PhylomeDBiQ5T0J7.
    TreeFamiTF337831.

    Family and domain databases

    InterProiIPR027874. Tex35.
    [Graphical view]
    PfamiPF15079. DUF4546. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5T0J7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSAKRAELKK THLSKNYKAV CLELKPEPTK TFDYKAVKQE GRFTKAGVTQ    50
    DLKNELREVR EELKEKMEEI KQIKDLMDKD FDKLHEFVEI MKEMQKDMDE 100
    KMDILINTQK NYKLPLRRAP KEQQELRLMG KTHREPQLRP KKMDGASGVN 150
    GAPCALHKKT MAPQKTKQGS LDPLHHCGTC CEKCLLCALK NNYNRGNIPS 200
    EASGLYKGGE EPVTTQPSVG HAVPAPKSQT EGR 233
    Length:233
    Mass (Da):26,518
    Last modified:December 21, 2004 - v1
    Checksum:i0B8B9168E1809B05
    GO
    Isoform 2 (identifier: Q5T0J7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         13-13: L → LVKERHCWT
         196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → GIYAAVGLLDLW

    Show »
    Length:215
    Mass (Da):25,014
    Checksum:iB34BB92695CB7868
    GO
    Isoform 3 (identifier: Q5T0J7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         182-233: EKCLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → VSETLPEPSTGARPLAPAPW

    Show »
    Length:201
    Mass (Da):23,096
    Checksum:iB6B7161A1248EF65
    GO
    Isoform 4 (identifier: Q5T0J7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-76: Missing.
         196-233: GNIPSEASGL...PAPKSQTEGR → AAPLKEARHL...MRDEINSERR

    Show »
    Length:179
    Mass (Da):20,199
    Checksum:i28CAC48DF030515F
    GO
    Isoform 5 (identifier: Q5T0J7-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → AQLQNLPAVPIHHLQAP

    Show »
    Length:212
    Mass (Da):24,531
    Checksum:iA23C8F537A6CD276
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti14 – 141S → C in CAB66629. (PubMed:11230166)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti55 – 551E → G.
    Corresponds to variant rs16852957 [ dbSNP | Ensembl ].
    VAR_027656
    Natural varianti146 – 1461A → G.
    Corresponds to variant rs12079481 [ dbSNP | Ensembl ].
    VAR_027657
    Natural varianti171 – 1711L → P.
    Corresponds to variant rs3813636 [ dbSNP | Ensembl ].
    VAR_059592
    Natural varianti171 – 1711L → R.1 Publication
    Corresponds to variant rs3813636 [ dbSNP | Ensembl ].
    VAR_027658

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7676Missing in isoform 4. 1 PublicationVSP_020737Add
    BLAST
    Alternative sequencei13 – 131L → LVKERHCWT in isoform 2. 1 PublicationVSP_020738
    Alternative sequencei182 – 23352EKCLL…QTEGR → VSETLPEPSTGARPLAPAPW in isoform 3. 1 PublicationVSP_020739Add
    BLAST
    Alternative sequencei196 – 23338GNIPS…QTEGR → GIYAAVGLLDLW in isoform 2. 1 PublicationVSP_020740Add
    BLAST
    Alternative sequencei196 – 23338GNIPS…QTEGR → AAPLKEARHLLTANSIDPSA ALVLLIEFLLLTLVTGAAAP GLDACGHQRNMRDEINSERR in isoform 4. 1 PublicationVSP_020741Add
    BLAST
    Alternative sequencei196 – 23338GNIPS…QTEGR → AQLQNLPAVPIHHLQAP in isoform 5. CuratedVSP_045739Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL136694 mRNA. Translation: CAB66629.1.
    AK093269 mRNA. Translation: BAC04115.1.
    AK097518 mRNA. Translation: BAC05085.1.
    AL513013 Genomic DNA. Translation: CAI23535.1.
    AL513013 Genomic DNA. Translation: CAI23536.1.
    AL513013 Genomic DNA. Translation: CAI23537.1.
    AL513013 Genomic DNA. Translation: CAI23538.1.
    BC034972 mRNA. Translation: AAH34972.1.
    CCDSiCCDS1323.1. [Q5T0J7-1]
    CCDS53433.1. [Q5T0J7-5]
    CCDS53434.1. [Q5T0J7-2]
    RefSeqiNP_001164193.1. NM_001170722.1. [Q5T0J7-2]
    NP_001164194.1. NM_001170723.1. [Q5T0J7-5]
    NP_001164195.1. NM_001170724.1.
    NP_115502.2. NM_032126.4. [Q5T0J7-1]
    UniGeneiHs.534501.

    Genome annotation databases

    EnsembliENST00000319416; ENSP00000323795; ENSG00000240021. [Q5T0J7-1]
    ENST00000367639; ENSP00000356611; ENSG00000240021. [Q5T0J7-2]
    ENST00000367641; ENSP00000356613; ENSG00000240021. [Q5T0J7-3]
    ENST00000367643; ENSP00000356615; ENSG00000240021. [Q5T0J7-5]
    GeneIDi84066.
    KEGGihsa:84066.
    UCSCiuc001glt.2. human. [Q5T0J7-1]
    uc001glu.1. human. [Q5T0J7-3]
    uc001glw.2. human. [Q5T0J7-2]
    uc021pfd.1. human.

    Polymorphism databases

    DMDMi74744310.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL136694 mRNA. Translation: CAB66629.1 .
    AK093269 mRNA. Translation: BAC04115.1 .
    AK097518 mRNA. Translation: BAC05085.1 .
    AL513013 Genomic DNA. Translation: CAI23535.1 .
    AL513013 Genomic DNA. Translation: CAI23536.1 .
    AL513013 Genomic DNA. Translation: CAI23537.1 .
    AL513013 Genomic DNA. Translation: CAI23538.1 .
    BC034972 mRNA. Translation: AAH34972.1 .
    CCDSi CCDS1323.1. [Q5T0J7-1 ]
    CCDS53433.1. [Q5T0J7-5 ]
    CCDS53434.1. [Q5T0J7-2 ]
    RefSeqi NP_001164193.1. NM_001170722.1. [Q5T0J7-2 ]
    NP_001164194.1. NM_001170723.1. [Q5T0J7-5 ]
    NP_001164195.1. NM_001170724.1.
    NP_115502.2. NM_032126.4. [Q5T0J7-1 ]
    UniGenei Hs.534501.

    3D structure databases

    ProteinModelPortali Q5T0J7.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123861. 4 interactions.
    IntActi Q5T0J7. 3 interactions.
    MINTi MINT-4725644.
    STRINGi 9606.ENSP00000323795.

    PTM databases

    PhosphoSitei Q5T0J7.

    Polymorphism databases

    DMDMi 74744310.

    Proteomic databases

    PaxDbi Q5T0J7.
    PRIDEi Q5T0J7.

    Protocols and materials databases

    DNASUi 84066.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000319416 ; ENSP00000323795 ; ENSG00000240021 . [Q5T0J7-1 ]
    ENST00000367639 ; ENSP00000356611 ; ENSG00000240021 . [Q5T0J7-2 ]
    ENST00000367641 ; ENSP00000356613 ; ENSG00000240021 . [Q5T0J7-3 ]
    ENST00000367643 ; ENSP00000356615 ; ENSG00000240021 . [Q5T0J7-5 ]
    GeneIDi 84066.
    KEGGi hsa:84066.
    UCSCi uc001glt.2. human. [Q5T0J7-1 ]
    uc001glu.1. human. [Q5T0J7-3 ]
    uc001glw.2. human. [Q5T0J7-2 ]
    uc021pfd.1. human.

    Organism-specific databases

    CTDi 84066.
    GeneCardsi GC01P178484.
    HGNCi HGNC:25366. TEX35.
    HPAi HPA039190.
    HPA041719.
    neXtProti NX_Q5T0J7.
    PharmGKBi PA134904440.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG39358.
    HOGENOMi HOG000111219.
    HOVERGENi HBG058182.
    InParanoidi Q5T0J7.
    OMAi PLDSLHQ.
    OrthoDBi EOG74XS84.
    PhylomeDBi Q5T0J7.
    TreeFami TF337831.

    Miscellaneous databases

    GeneWikii C1orf49.
    GenomeRNAii 84066.
    NextBioi 73243.

    Gene expression databases

    ArrayExpressi Q5T0J7.
    Bgeei Q5T0J7.
    CleanExi HS_C1orf49.
    Genevestigatori Q5T0J7.

    Family and domain databases

    InterProi IPR027874. Tex35.
    [Graphical view ]
    Pfami PF15079. DUF4546. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Fetal brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT ARG-171.
      Tissue: Testis.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    5. "Identification and characteristics of a novel testis-specific gene, Tsc24, in human and mice."
      Tang A., Yu Z., Gui Y., Guo X., Long Y., Cai Z.
      Biol. Pharm. Bull. 29:2187-2191(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiTEX35_HUMAN
    AccessioniPrimary (citable) accession number: Q5T0J7
    Secondary accession number(s): Q5T0J8
    , Q5T0J9, Q8IYU6, Q8N7Z1, Q8NA15, Q9H0Q7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 3, 2006
    Last sequence update: December 21, 2004
    Last modified: October 1, 2014
    This is version 80 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations

    External Data

    Dasty 3