Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5T0J7 (TEX35_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 79. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Testis-expressed sequence 35 protein
Gene names
Name:Tex35
Synonyms:C1orf49
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length233 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Tissue specificity

Testis-specific. Ref.5

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentmicrotubule cytoskeleton

Inferred from direct assay. Source: LIFEdb

nucleus

Inferred from sequence or structural similarity. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5T0J7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5T0J7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     13-13: L → LVKERHCWT
     196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → GIYAAVGLLDLW
Isoform 3 (identifier: Q5T0J7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     182-233: EKCLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → VSETLPEPSTGARPLAPAPW
Isoform 4 (identifier: Q5T0J7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-76: Missing.
     196-233: GNIPSEASGL...PAPKSQTEGR → AAPLKEARHL...MRDEINSERR
Isoform 5 (identifier: Q5T0J7-5)

The sequence of this isoform differs from the canonical sequence as follows:
     196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → AQLQNLPAVPIHHLQAP

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 233233Testis-expressed sequence 35 protein
PRO_0000251187

Regions

Coiled coil45 – 11167 Potential

Natural variations

Alternative sequence1 – 7676Missing in isoform 4.
VSP_020737
Alternative sequence131L → LVKERHCWT in isoform 2.
VSP_020738
Alternative sequence182 – 23352EKCLL…QTEGR → VSETLPEPSTGARPLAPAPW in isoform 3.
VSP_020739
Alternative sequence196 – 23338GNIPS…QTEGR → GIYAAVGLLDLW in isoform 2.
VSP_020740
Alternative sequence196 – 23338GNIPS…QTEGR → AAPLKEARHLLTANSIDPSA ALVLLIEFLLLTLVTGAAAP GLDACGHQRNMRDEINSERR in isoform 4.
VSP_020741
Alternative sequence196 – 23338GNIPS…QTEGR → AQLQNLPAVPIHHLQAP in isoform 5.
VSP_045739
Natural variant551E → G.
Corresponds to variant rs16852957 [ dbSNP | Ensembl ].
VAR_027656
Natural variant1461A → G.
Corresponds to variant rs12079481 [ dbSNP | Ensembl ].
VAR_027657
Natural variant1711L → P.
Corresponds to variant rs3813636 [ dbSNP | Ensembl ].
VAR_059592
Natural variant1711L → R. Ref.2
Corresponds to variant rs3813636 [ dbSNP | Ensembl ].
VAR_027658

Experimental info

Sequence conflict141S → C in CAB66629. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 21, 2004. Version 1.
Checksum: 0B8B9168E1809B05

FASTA23326,518
        10         20         30         40         50         60 
MSAKRAELKK THLSKNYKAV CLELKPEPTK TFDYKAVKQE GRFTKAGVTQ DLKNELREVR 

        70         80         90        100        110        120 
EELKEKMEEI KQIKDLMDKD FDKLHEFVEI MKEMQKDMDE KMDILINTQK NYKLPLRRAP 

       130        140        150        160        170        180 
KEQQELRLMG KTHREPQLRP KKMDGASGVN GAPCALHKKT MAPQKTKQGS LDPLHHCGTC 

       190        200        210        220        230 
CEKCLLCALK NNYNRGNIPS EASGLYKGGE EPVTTQPSVG HAVPAPKSQT EGR 

« Hide

Isoform 2 [UniParc].

Checksum: B34BB92695CB7868
Show »

FASTA21525,014
Isoform 3 [UniParc].

Checksum: B6B7161A1248EF65
Show »

FASTA20123,096
Isoform 4 [UniParc].

Checksum: 28CAC48DF030515F
Show »

FASTA17920,199
Isoform 5 [UniParc].

Checksum: A23C8F537A6CD276
Show »

FASTA21224,531

References

« Hide 'large scale' references
[1]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Fetal brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT ARG-171.
Tissue: Testis.
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
[5]"Identification and characteristics of a novel testis-specific gene, Tsc24, in human and mice."
Tang A., Yu Z., Gui Y., Guo X., Long Y., Cai Z.
Biol. Pharm. Bull. 29:2187-2191(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AL136694 mRNA. Translation: CAB66629.1.
AK093269 mRNA. Translation: BAC04115.1.
AK097518 mRNA. Translation: BAC05085.1.
AL513013 Genomic DNA. Translation: CAI23535.1.
AL513013 Genomic DNA. Translation: CAI23536.1.
AL513013 Genomic DNA. Translation: CAI23537.1.
AL513013 Genomic DNA. Translation: CAI23538.1.
BC034972 mRNA. Translation: AAH34972.1.
CCDSCCDS1323.1. [Q5T0J7-1]
CCDS53433.1. [Q5T0J7-5]
CCDS53434.1. [Q5T0J7-2]
RefSeqNP_001164193.1. NM_001170722.1. [Q5T0J7-2]
NP_001164194.1. NM_001170723.1. [Q5T0J7-5]
NP_001164195.1. NM_001170724.1.
NP_115502.2. NM_032126.4. [Q5T0J7-1]
UniGeneHs.534501.

3D structure databases

ProteinModelPortalQ5T0J7.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123861. 4 interactions.
IntActQ5T0J7. 3 interactions.
MINTMINT-4725644.
STRING9606.ENSP00000323795.

PTM databases

PhosphoSiteQ5T0J7.

Polymorphism databases

DMDM74744310.

Proteomic databases

PaxDbQ5T0J7.
PRIDEQ5T0J7.

Protocols and materials databases

DNASU84066.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000258298; ENSP00000258298; ENSG00000240021. [Q5T0J7-4]
ENST00000319416; ENSP00000323795; ENSG00000240021. [Q5T0J7-1]
ENST00000367639; ENSP00000356611; ENSG00000240021. [Q5T0J7-2]
ENST00000367641; ENSP00000356613; ENSG00000240021. [Q5T0J7-3]
ENST00000367643; ENSP00000356615; ENSG00000240021. [Q5T0J7-5]
GeneID84066.
KEGGhsa:84066.
UCSCuc001glt.2. human. [Q5T0J7-1]
uc001glu.1. human. [Q5T0J7-3]
uc001glw.2. human. [Q5T0J7-2]
uc021pfd.1. human.

Organism-specific databases

CTD84066.
GeneCardsGC01P178484.
HGNCHGNC:25366. TEX35.
HPAHPA039190.
HPA041719.
neXtProtNX_Q5T0J7.
PharmGKBPA134904440.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG39358.
HOGENOMHOG000111219.
HOVERGENHBG058182.
InParanoidQ5T0J7.
OMAPLDSLHQ.
OrthoDBEOG74XS84.
PhylomeDBQ5T0J7.
TreeFamTF337831.

Gene expression databases

ArrayExpressQ5T0J7.
BgeeQ5T0J7.
CleanExHS_C1orf49.
GenevestigatorQ5T0J7.

Family and domain databases

InterProIPR027874. Tex35.
[Graphical view]
PfamPF15079. DUF4546. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiC1orf49.
GenomeRNAi84066.
NextBio73243.

Entry information

Entry nameTEX35_HUMAN
AccessionPrimary (citable) accession number: Q5T0J7
Secondary accession number(s): Q5T0J8 expand/collapse secondary AC list , Q5T0J9, Q8IYU6, Q8N7Z1, Q8NA15, Q9H0Q7
Entry history
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: December 21, 2004
Last modified: July 9, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM