Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Testis-expressed protein 35

Gene

TEX35

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Testis-expressed protein 35
Gene namesi
Name:TEX35
Synonyms:C1orf49
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000240021.9
HGNCiHGNC:25366 TEX35
neXtProtiNX_Q5T0J7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi84066
OpenTargetsiENSG00000240021
PharmGKBiPA134904440

Polymorphism and mutation databases

BioMutaiTex35
DMDMi74744310

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002511871 – 233Testis-expressed protein 35Add BLAST233

Proteomic databases

PaxDbiQ5T0J7
PeptideAtlasiQ5T0J7
PRIDEiQ5T0J7
ProteomicsDBi64172
64173 [Q5T0J7-2]
64174 [Q5T0J7-3]
64175 [Q5T0J7-4]

PTM databases

iPTMnetiQ5T0J7
PhosphoSitePlusiQ5T0J7

Expressioni

Tissue specificityi

Testis-specific.1 Publication

Gene expression databases

BgeeiENSG00000240021
CleanExiHS_C1orf49
ExpressionAtlasiQ5T0J7 baseline and differential
GenevisibleiQ5T0J7 HS

Organism-specific databases

HPAiHPA039190

Interactioni

Protein-protein interaction databases

BioGridi123861, 28 interactors
IntActiQ5T0J7, 5 interactors
MINTiQ5T0J7
STRINGi9606.ENSP00000323795

Structurei

3D structure databases

ProteinModelPortaliQ5T0J7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili45 – 111Sequence analysisAdd BLAST67

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IZ1Y Eukaryota
ENOG411197W LUCA
GeneTreeiENSGT00390000011962
HOGENOMiHOG000111219
HOVERGENiHBG058182
InParanoidiQ5T0J7
OMAiQIKDVMD
OrthoDBiEOG091G0VGU
PhylomeDBiQ5T0J7
TreeFamiTF337831

Family and domain databases

InterProiView protein in InterPro
IPR027874 Tex35
PANTHERiPTHR36860 PTHR36860, 1 hit
PfamiView protein in Pfam
PF15079 Tsc35, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5T0J7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAKRAELKK THLSKNYKAV CLELKPEPTK TFDYKAVKQE GRFTKAGVTQ
60 70 80 90 100
DLKNELREVR EELKEKMEEI KQIKDLMDKD FDKLHEFVEI MKEMQKDMDE
110 120 130 140 150
KMDILINTQK NYKLPLRRAP KEQQELRLMG KTHREPQLRP KKMDGASGVN
160 170 180 190 200
GAPCALHKKT MAPQKTKQGS LDPLHHCGTC CEKCLLCALK NNYNRGNIPS
210 220 230
EASGLYKGGE EPVTTQPSVG HAVPAPKSQT EGR
Length:233
Mass (Da):26,518
Last modified:December 21, 2004 - v1
Checksum:i0B8B9168E1809B05
GO
Isoform 2 (identifier: Q5T0J7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     13-13: L → LVKERHCWT
     196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → GIYAAVGLLDLW

Show »
Length:215
Mass (Da):25,014
Checksum:iB34BB92695CB7868
GO
Isoform 3 (identifier: Q5T0J7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-233: EKCLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → VSETLPEPSTGARPLAPAPW

Show »
Length:201
Mass (Da):23,096
Checksum:iB6B7161A1248EF65
GO
Isoform 4 (identifier: Q5T0J7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-76: Missing.
     196-233: GNIPSEASGL...PAPKSQTEGR → AAPLKEARHL...MRDEINSERR

Show »
Length:179
Mass (Da):20,199
Checksum:i28CAC48DF030515F
GO
Isoform 5 (identifier: Q5T0J7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → AQLQNLPAVPIHHLQAP

Show »
Length:212
Mass (Da):24,531
Checksum:iA23C8F537A6CD276
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti14S → C in CAB66629 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02765655E → G. Corresponds to variant dbSNP:rs16852957Ensembl.1
Natural variantiVAR_027657146A → G. Corresponds to variant dbSNP:rs12079481Ensembl.1
Natural variantiVAR_059592171L → P. Corresponds to variant dbSNP:rs3813636Ensembl.1
Natural variantiVAR_027658171L → R1 PublicationCorresponds to variant dbSNP:rs3813636Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0207371 – 76Missing in isoform 4. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_02073813L → LVKERHCWT in isoform 2. 1 Publication1
Alternative sequenceiVSP_020739182 – 233EKCLL…QTEGR → VSETLPEPSTGARPLAPAPW in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_020740196 – 233GNIPS…QTEGR → GIYAAVGLLDLW in isoform 2. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_020741196 – 233GNIPS…QTEGR → AAPLKEARHLLTANSIDPSA ALVLLIEFLLLTLVTGAAAP GLDACGHQRNMRDEINSERR in isoform 4. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_045739196 – 233GNIPS…QTEGR → AQLQNLPAVPIHHLQAP in isoform 5. CuratedAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136694 mRNA Translation: CAB66629.1
AK093269 mRNA Translation: BAC04115.1
AK097518 mRNA Translation: BAC05085.1
AL513013 Genomic DNA No translation available.
BC034972 mRNA Translation: AAH34972.1
CCDSiCCDS1323.1 [Q5T0J7-1]
CCDS53433.1 [Q5T0J7-5]
CCDS53434.1 [Q5T0J7-2]
RefSeqiNP_001164193.1, NM_001170722.1 [Q5T0J7-2]
NP_001164194.1, NM_001170723.1 [Q5T0J7-5]
NP_001164195.1, NM_001170724.1
NP_115502.2, NM_032126.4 [Q5T0J7-1]
UniGeneiHs.534501

Genome annotation databases

EnsembliENST00000319416; ENSP00000323795; ENSG00000240021 [Q5T0J7-1]
ENST00000367639; ENSP00000356611; ENSG00000240021 [Q5T0J7-2]
ENST00000367641; ENSP00000356613; ENSG00000240021 [Q5T0J7-3]
ENST00000367643; ENSP00000356615; ENSG00000240021 [Q5T0J7-5]
GeneIDi84066
KEGGihsa:84066
UCSCiuc001glt.3 human [Q5T0J7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTEX35_HUMAN
AccessioniPrimary (citable) accession number: Q5T0J7
Secondary accession number(s): Q5T0J8
, Q5T0J9, Q8IYU6, Q8N7Z1, Q8NA15, Q9H0Q7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: December 21, 2004
Last modified: June 20, 2018
This is version 103 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health