SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5T0J7

- TEX35_HUMAN

UniProt

Q5T0J7 - TEX35_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Testis-expressed sequence 35 protein
Gene
Tex35, C1orf49
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Testis-expressed sequence 35 protein
Gene namesi
Name:Tex35
Synonyms:C1orf49
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:25366. TEX35.

Subcellular locationi

GO - Cellular componenti

  1. microtubule cytoskeleton Source: LIFEdb
  2. nucleus Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134904440.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 233233Testis-expressed sequence 35 protein
PRO_0000251187Add
BLAST

Proteomic databases

PaxDbiQ5T0J7.
PRIDEiQ5T0J7.

PTM databases

PhosphoSiteiQ5T0J7.

Expressioni

Tissue specificityi

Testis-specific.1 Publication

Gene expression databases

ArrayExpressiQ5T0J7.
BgeeiQ5T0J7.
CleanExiHS_C1orf49.
GenevestigatoriQ5T0J7.

Organism-specific databases

HPAiHPA039190.
HPA041719.

Interactioni

Protein-protein interaction databases

BioGridi123861. 4 interactions.
IntActiQ5T0J7. 3 interactions.
MINTiMINT-4725644.
STRINGi9606.ENSP00000323795.

Structurei

3D structure databases

ProteinModelPortaliQ5T0J7.

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili45 – 11167 Reviewed prediction
Add
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG39358.
HOGENOMiHOG000111219.
HOVERGENiHBG058182.
InParanoidiQ5T0J7.
OMAiPLDSLHQ.
OrthoDBiEOG74XS84.
PhylomeDBiQ5T0J7.
TreeFamiTF337831.

Family and domain databases

InterProiIPR027874. Tex35.
[Graphical view]
PfamiPF15079. DUF4546. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5T0J7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSAKRAELKK THLSKNYKAV CLELKPEPTK TFDYKAVKQE GRFTKAGVTQ    50
DLKNELREVR EELKEKMEEI KQIKDLMDKD FDKLHEFVEI MKEMQKDMDE 100
KMDILINTQK NYKLPLRRAP KEQQELRLMG KTHREPQLRP KKMDGASGVN 150
GAPCALHKKT MAPQKTKQGS LDPLHHCGTC CEKCLLCALK NNYNRGNIPS 200
EASGLYKGGE EPVTTQPSVG HAVPAPKSQT EGR 233
Length:233
Mass (Da):26,518
Last modified:December 21, 2004 - v1
Checksum:i0B8B9168E1809B05
GO
Isoform 2 (identifier: Q5T0J7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     13-13: L → LVKERHCWT
     196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → GIYAAVGLLDLW

Show »
Length:215
Mass (Da):25,014
Checksum:iB34BB92695CB7868
GO
Isoform 3 (identifier: Q5T0J7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-233: EKCLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → VSETLPEPSTGARPLAPAPW

Show »
Length:201
Mass (Da):23,096
Checksum:iB6B7161A1248EF65
GO
Isoform 4 (identifier: Q5T0J7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-76: Missing.
     196-233: GNIPSEASGL...PAPKSQTEGR → AAPLKEARHL...MRDEINSERR

Show »
Length:179
Mass (Da):20,199
Checksum:i28CAC48DF030515F
GO
Isoform 5 (identifier: Q5T0J7-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → AQLQNLPAVPIHHLQAP

Show »
Length:212
Mass (Da):24,531
Checksum:iA23C8F537A6CD276
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti55 – 551E → G.
Corresponds to variant rs16852957 [ dbSNP | Ensembl ].
VAR_027656
Natural varianti146 – 1461A → G.
Corresponds to variant rs12079481 [ dbSNP | Ensembl ].
VAR_027657
Natural varianti171 – 1711L → P.
Corresponds to variant rs3813636 [ dbSNP | Ensembl ].
VAR_059592
Natural varianti171 – 1711L → R.1 Publication
Corresponds to variant rs3813636 [ dbSNP | Ensembl ].
VAR_027658

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7676Missing in isoform 4.
VSP_020737Add
BLAST
Alternative sequencei13 – 131L → LVKERHCWT in isoform 2.
VSP_020738
Alternative sequencei182 – 23352EKCLL…QTEGR → VSETLPEPSTGARPLAPAPW in isoform 3.
VSP_020739Add
BLAST
Alternative sequencei196 – 23338GNIPS…QTEGR → GIYAAVGLLDLW in isoform 2.
VSP_020740Add
BLAST
Alternative sequencei196 – 23338GNIPS…QTEGR → AAPLKEARHLLTANSIDPSA ALVLLIEFLLLTLVTGAAAP GLDACGHQRNMRDEINSERR in isoform 4.
VSP_020741Add
BLAST
Alternative sequencei196 – 23338GNIPS…QTEGR → AQLQNLPAVPIHHLQAP in isoform 5.
VSP_045739Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti14 – 141S → C in CAB66629. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL136694 mRNA. Translation: CAB66629.1.
AK093269 mRNA. Translation: BAC04115.1.
AK097518 mRNA. Translation: BAC05085.1.
AL513013 Genomic DNA. Translation: CAI23535.1.
AL513013 Genomic DNA. Translation: CAI23536.1.
AL513013 Genomic DNA. Translation: CAI23537.1.
AL513013 Genomic DNA. Translation: CAI23538.1.
BC034972 mRNA. Translation: AAH34972.1.
CCDSiCCDS1323.1. [Q5T0J7-1]
CCDS53433.1. [Q5T0J7-5]
CCDS53434.1. [Q5T0J7-2]
RefSeqiNP_001164193.1. NM_001170722.1. [Q5T0J7-2]
NP_001164194.1. NM_001170723.1. [Q5T0J7-5]
NP_001164195.1. NM_001170724.1.
NP_115502.2. NM_032126.4. [Q5T0J7-1]
UniGeneiHs.534501.

Genome annotation databases

EnsembliENST00000258298; ENSP00000258298; ENSG00000240021. [Q5T0J7-4]
ENST00000319416; ENSP00000323795; ENSG00000240021. [Q5T0J7-1]
ENST00000367639; ENSP00000356611; ENSG00000240021. [Q5T0J7-2]
ENST00000367641; ENSP00000356613; ENSG00000240021. [Q5T0J7-3]
ENST00000367643; ENSP00000356615; ENSG00000240021. [Q5T0J7-5]
GeneIDi84066.
KEGGihsa:84066.
UCSCiuc001glt.2. human. [Q5T0J7-1]
uc001glu.1. human. [Q5T0J7-3]
uc001glw.2. human. [Q5T0J7-2]
uc021pfd.1. human.

Polymorphism databases

DMDMi74744310.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL136694 mRNA. Translation: CAB66629.1 .
AK093269 mRNA. Translation: BAC04115.1 .
AK097518 mRNA. Translation: BAC05085.1 .
AL513013 Genomic DNA. Translation: CAI23535.1 .
AL513013 Genomic DNA. Translation: CAI23536.1 .
AL513013 Genomic DNA. Translation: CAI23537.1 .
AL513013 Genomic DNA. Translation: CAI23538.1 .
BC034972 mRNA. Translation: AAH34972.1 .
CCDSi CCDS1323.1. [Q5T0J7-1 ]
CCDS53433.1. [Q5T0J7-5 ]
CCDS53434.1. [Q5T0J7-2 ]
RefSeqi NP_001164193.1. NM_001170722.1. [Q5T0J7-2 ]
NP_001164194.1. NM_001170723.1. [Q5T0J7-5 ]
NP_001164195.1. NM_001170724.1.
NP_115502.2. NM_032126.4. [Q5T0J7-1 ]
UniGenei Hs.534501.

3D structure databases

ProteinModelPortali Q5T0J7.
ModBasei Search...

Protein-protein interaction databases

BioGridi 123861. 4 interactions.
IntActi Q5T0J7. 3 interactions.
MINTi MINT-4725644.
STRINGi 9606.ENSP00000323795.

PTM databases

PhosphoSitei Q5T0J7.

Polymorphism databases

DMDMi 74744310.

Proteomic databases

PaxDbi Q5T0J7.
PRIDEi Q5T0J7.

Protocols and materials databases

DNASUi 84066.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000258298 ; ENSP00000258298 ; ENSG00000240021 . [Q5T0J7-4 ]
ENST00000319416 ; ENSP00000323795 ; ENSG00000240021 . [Q5T0J7-1 ]
ENST00000367639 ; ENSP00000356611 ; ENSG00000240021 . [Q5T0J7-2 ]
ENST00000367641 ; ENSP00000356613 ; ENSG00000240021 . [Q5T0J7-3 ]
ENST00000367643 ; ENSP00000356615 ; ENSG00000240021 . [Q5T0J7-5 ]
GeneIDi 84066.
KEGGi hsa:84066.
UCSCi uc001glt.2. human. [Q5T0J7-1 ]
uc001glu.1. human. [Q5T0J7-3 ]
uc001glw.2. human. [Q5T0J7-2 ]
uc021pfd.1. human.

Organism-specific databases

CTDi 84066.
GeneCardsi GC01P178484.
HGNCi HGNC:25366. TEX35.
HPAi HPA039190.
HPA041719.
neXtProti NX_Q5T0J7.
PharmGKBi PA134904440.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG39358.
HOGENOMi HOG000111219.
HOVERGENi HBG058182.
InParanoidi Q5T0J7.
OMAi PLDSLHQ.
OrthoDBi EOG74XS84.
PhylomeDBi Q5T0J7.
TreeFami TF337831.

Miscellaneous databases

GeneWikii C1orf49.
GenomeRNAii 84066.
NextBioi 73243.

Gene expression databases

ArrayExpressi Q5T0J7.
Bgeei Q5T0J7.
CleanExi HS_C1orf49.
Genevestigatori Q5T0J7.

Family and domain databases

InterProi IPR027874. Tex35.
[Graphical view ]
Pfami PF15079. DUF4546. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Fetal brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT ARG-171.
    Tissue: Testis.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  5. "Identification and characteristics of a novel testis-specific gene, Tsc24, in human and mice."
    Tang A., Yu Z., Gui Y., Guo X., Long Y., Cai Z.
    Biol. Pharm. Bull. 29:2187-2191(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiTEX35_HUMAN
AccessioniPrimary (citable) accession number: Q5T0J7
Secondary accession number(s): Q5T0J8
, Q5T0J9, Q8IYU6, Q8N7Z1, Q8NA15, Q9H0Q7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: December 21, 2004
Last modified: July 9, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

External Data

Dasty 3

Similar proteinsi