Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil and C2 domain-containing protein 1B

Gene

CC2D1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcription factor that binds specifically to the DRE (dual repressor element) and represses HTR1A gene transcription in neuronal cells.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil and C2 domain-containing protein 1B
Alternative name(s):
Five prime repressor element under dual repression-binding protein 2
Short name:
FRE under dual repression-binding protein 2
Short name:
Freud-2
Gene namesi
Name:CC2D1B
Synonyms:KIAA1836
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:29386. CC2D1B.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672198.

Polymorphism and mutation databases

BioMutaiCC2D1B.
DMDMi74744295.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 858858Coiled-coil and C2 domain-containing protein 1BPRO_0000288426Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei209 – 2091PhosphoserineCombined sources
Modified residuei593 – 5931PhosphoserineBy similarity
Modified residuei596 – 5961PhosphothreonineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ5T0F9.
MaxQBiQ5T0F9.
PaxDbiQ5T0F9.
PeptideAtlasiQ5T0F9.
PRIDEiQ5T0F9.

PTM databases

iPTMnetiQ5T0F9.
PhosphoSiteiQ5T0F9.

Expressioni

Tissue specificityi

Widely distributed in brain and peripheral tissues.1 Publication

Gene expression databases

BgeeiQ5T0F9.
CleanExiHS_CC2D1B.
ExpressionAtlasiQ5T0F9. baseline and differential.
GenevisibleiQ5T0F9. HS.

Organism-specific databases

HPAiHPA027500.
HPA031426.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
MDFIQ997503EBI-10245204,EBI-724076

Protein-protein interaction databases

BioGridi128291. 12 interactions.
IntActiQ5T0F9. 3 interactions.
STRINGi9606.ENSP00000360642.

Structurei

3D structure databases

ProteinModelPortaliQ5T0F9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini686 – 799114C2Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili166 – 21247Sequence analysisAdd
BLAST
Coiled coili611 – 63525Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi91 – 14353Glu-richAdd
BLAST
Compositional biasi222 – 27958Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the CC2D1 family.Curated
Contains 1 C2 domain.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG3837. Eukaryota.
ENOG410XPM7. LUCA.
GeneTreeiENSGT00390000009595.
HOVERGENiHBG100866.
InParanoidiQ5T0F9.
KOiK18260.
OMAiMVTENWL.
OrthoDBiEOG71G9TB.
PhylomeDBiQ5T0F9.
TreeFamiTF314229.

Family and domain databases

Gene3Di2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
IPR006608. DM14.
[Graphical view]
PfamiPF00168. C2. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 1 hit.
SM00685. DM14. 4 hits.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5T0F9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMPGPRPRKG PQARGQGVAA AKQMGLFMEF GPEDMLLGMD EAEDDEDLEA
60 70 80 90 100
ELLALTGEAQ TTGKKPAPKG QAPLPMAHIE KLAADCMRDV EEEEEEEGLE
110 120 130 140 150
EDAELLTELQ EVLGVDEETE PLDGDEVADP GGSEEENGLE DTEPPVQTAV
160 170 180 190 200
LTASAPAAQA GASQGLHALL EERIHNYREA AASAKEAGEA AKARRCERGL
210 220 230 240 250
KTLESQLASV RRGRKINEDE IPPPVALGKR PLAPQEPANR SPETDPPAPP
260 270 280 290 300
ALESDNPSQP ETSLPGISAQ PVSDLDPDPR ALLSSRQREY KVAALSAKRA
310 320 330 340 350
GELDRARELM RIGKRFGAVL EALEKGQPVD LSAMPPAPED LKPQQASQAP
360 370 380 390 400
TAPSVIPPAV ERVQPVMAPD VPATPVAPTE SQTVLDALQQ RLNKYREAGI
410 420 430 440 450
QARSGGDERK ARMHERIAKQ YQDAIRAHRA GRKVNFAELP VPPGFPPIPG
460 470 480 490 500
LESTMGVEED AVAATLAAAE KLASAEDSAP ADKDEDEPPG HLQGEPPAQA
510 520 530 540 550
PVAKKPARPT VPSSQRLPEP RASSSKESPS PSVREQLALL EARKLQYQRA
560 570 580 590 600
ALQAKRSQDL EQAKAYLRVA KWLEAQIIQA RSGRPVDLSK VPSPLTDEEG
610 620 630 640 650
DFILIHHEDL RLSQKAEEVY AQLQKMLLEQ QEKCLLFSKQ FMHQGNVAET
660 670 680 690 700
TRFEKLAQDR KKQLEILQLA QAQGLDPPTH HFELKTFQTV RIFSELNSTE
710 720 730 740 750
MHLIIVRGMN LPAPPGVTPD DLDAFVRFEF HYPNSDQAQK SKTAVVKNTN
760 770 780 790 800
SPEFDQLFKL NINRNHRGFK RVIQSKGIKF EIFHKGSFFR SDKLVGTAHL
810 820 830 840 850
KLERLENECE IREIVEVLDG RKPTGGKLEV KVRLREPLSG QDVQMVTENW

LVLEPRGL
Length:858
Mass (Da):94,224
Last modified:December 21, 2004 - v1
Checksum:i338DC0A1ED792CDA
GO
Isoform 2 (identifier: Q5T0F9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     488-493: Missing.

Show »
Length:852
Mass (Da):93,595
Checksum:iC494448E2DF76987
GO
Isoform 3 (identifier: Q5T0F9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-309: Missing.
     488-493: Missing.
     832-858: VRLREPLSGQDVQMVTENWLVLEPRGL → PMASTRRGVRPRLCRR

Show »
Length:532
Mass (Da):59,372
Checksum:i2480943BE20DF555
GO
Isoform 4 (identifier: Q5T0F9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-625: Missing.
     817-858: VLDGRKPTGGKLEVKVRLREPLSGQDVQMVTENWLVLEPRGL → MERFRRSEKSHRGTQEKAASLFP

Show »
Length:214
Mass (Da):24,969
Checksum:iC0CACB7B60DEFC07
GO
Isoform 5 (identifier: Q5T0F9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-123: ELLTELQEVLGVDEETEPLD → GRDCAGDDFPSFAGFRSLCT
     124-858: Missing.

Show »
Length:123
Mass (Da):13,229
Checksum:i9F32143025319246
GO

Sequence cautioni

The sequence BAC85450.1 differs from that shown.Curated
The sequence CAI12282.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti35 – 351M → T.
Corresponds to variant rs11555349 [ dbSNP | Ensembl ].
VAR_062191

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 625625Missing in isoform 4. 1 PublicationVSP_025658Add
BLAST
Alternative sequencei1 – 309309Missing in isoform 3. 1 PublicationVSP_025657Add
BLAST
Alternative sequencei104 – 12320ELLTE…TEPLD → GRDCAGDDFPSFAGFRSLCT in isoform 5. 1 PublicationVSP_025662Add
BLAST
Alternative sequencei124 – 858735Missing in isoform 5. 1 PublicationVSP_025663Add
BLAST
Alternative sequencei488 – 4936Missing in isoform 2 and isoform 3. 1 PublicationVSP_025659
Alternative sequencei817 – 85842VLDGR…EPRGL → MERFRRSEKSHRGTQEKAAS LFP in isoform 4. 1 PublicationVSP_025660Add
BLAST
Alternative sequencei832 – 85827VRLRE…EPRGL → PMASTRRGVRPRLCRR in isoform 3. 1 PublicationVSP_025661Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK130874 mRNA. Translation: BAC85450.1. Sequence problems.
AL513218 Genomic DNA. Translation: CAI12282.1. Sequence problems.
AL513218 Genomic DNA. Translation: CAI12283.1.
AL513218 Genomic DNA. Translation: CAI12284.1.
BC007912 mRNA. Translation: AAH07912.2.
BC016880 mRNA. Translation: AAH16880.1.
BC039308 mRNA. Translation: AAH39308.1.
AB058739 mRNA. Translation: BAB47465.1.
CCDSiCCDS30714.1. [Q5T0F9-1]
RefSeqiNP_115825.1. NM_032449.2. [Q5T0F9-1]
XP_005270647.1. XM_005270590.1. [Q5T0F9-1]
XP_005270648.1. XM_005270591.1. [Q5T0F9-2]
UniGeneiHs.591451.

Genome annotation databases

EnsembliENST00000284376; ENSP00000284376; ENSG00000154222. [Q5T0F9-2]
ENST00000371586; ENSP00000360642; ENSG00000154222. [Q5T0F9-1]
GeneIDi200014.
KEGGihsa:200014.
UCSCiuc001ctq.3. human. [Q5T0F9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK130874 mRNA. Translation: BAC85450.1. Sequence problems.
AL513218 Genomic DNA. Translation: CAI12282.1. Sequence problems.
AL513218 Genomic DNA. Translation: CAI12283.1.
AL513218 Genomic DNA. Translation: CAI12284.1.
BC007912 mRNA. Translation: AAH07912.2.
BC016880 mRNA. Translation: AAH16880.1.
BC039308 mRNA. Translation: AAH39308.1.
AB058739 mRNA. Translation: BAB47465.1.
CCDSiCCDS30714.1. [Q5T0F9-1]
RefSeqiNP_115825.1. NM_032449.2. [Q5T0F9-1]
XP_005270647.1. XM_005270590.1. [Q5T0F9-1]
XP_005270648.1. XM_005270591.1. [Q5T0F9-2]
UniGeneiHs.591451.

3D structure databases

ProteinModelPortaliQ5T0F9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128291. 12 interactions.
IntActiQ5T0F9. 3 interactions.
STRINGi9606.ENSP00000360642.

PTM databases

iPTMnetiQ5T0F9.
PhosphoSiteiQ5T0F9.

Polymorphism and mutation databases

BioMutaiCC2D1B.
DMDMi74744295.

Proteomic databases

EPDiQ5T0F9.
MaxQBiQ5T0F9.
PaxDbiQ5T0F9.
PeptideAtlasiQ5T0F9.
PRIDEiQ5T0F9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000284376; ENSP00000284376; ENSG00000154222. [Q5T0F9-2]
ENST00000371586; ENSP00000360642; ENSG00000154222. [Q5T0F9-1]
GeneIDi200014.
KEGGihsa:200014.
UCSCiuc001ctq.3. human. [Q5T0F9-1]

Organism-specific databases

CTDi200014.
GeneCardsiCC2D1B.
H-InvDBHIX0000583.
HGNCiHGNC:29386. CC2D1B.
HPAiHPA027500.
HPA031426.
neXtProtiNX_Q5T0F9.
PharmGKBiPA142672198.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3837. Eukaryota.
ENOG410XPM7. LUCA.
GeneTreeiENSGT00390000009595.
HOVERGENiHBG100866.
InParanoidiQ5T0F9.
KOiK18260.
OMAiMVTENWL.
OrthoDBiEOG71G9TB.
PhylomeDBiQ5T0F9.
TreeFamiTF314229.

Miscellaneous databases

ChiTaRSiCC2D1B. human.
GenomeRNAii200014.
PROiQ5T0F9.

Gene expression databases

BgeeiQ5T0F9.
CleanExiHS_CC2D1B.
ExpressionAtlasiQ5T0F9. baseline and differential.
GenevisibleiQ5T0F9. HS.

Family and domain databases

Gene3Di2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
IPR006608. DM14.
[Graphical view]
PfamiPF00168. C2. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 1 hit.
SM00685. DM14. 4 hits.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Umbilical cord.
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 462-858 (ISOFORM 2).
    Tissue: Skin, Testis and Uterus.
  4. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
    DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 141-858 (ISOFORM 1).
    Tissue: Brain.
  5. "Human Freud-2/CC2D1B: a novel repressor of postsynaptic serotonin-1A receptor expression."
    Hadjighassem M.R., Austin M.C., Szewczyk B., Daigle M., Stockmeier C.A., Albert P.R.
    Biol. Psychiatry 66:214-222(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Toward a comprehensive characterization of a human cancer cell phosphoproteome."
    Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J., Mohammed S.
    J. Proteome Res. 12:260-271(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-209, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Erythroleukemia.
  8. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiC2D1B_HUMAN
AccessioniPrimary (citable) accession number: Q5T0F9
Secondary accession number(s): Q49AE8
, Q5T0F8, Q5T0G0, Q6ZNQ1, Q96AP3, Q96I04, Q96JJ1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: December 21, 2004
Last modified: July 6, 2016
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.