Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium-dependent phosphate transport protein 3

Gene

Slc17a2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Important for the resorption of phosphate by the kidney. May be involved in actively transporting phosphate into cells via Na+ cotransport in the renal brush border membrane (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Symport, Transport

Keywords - Ligandi

Sodium

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium-dependent phosphate transport protein 3
Alternative name(s):
Na(+)/PI cotransporter 3
Sodium/phosphate cotransporter 3
Solute carrier family 17 member 2
Gene namesi
Name:Slc17a2
Synonyms:Npt3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:2443098. Slc17a2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei98 – 118HelicalSequence analysisAdd BLAST21
Transmembranei130 – 150HelicalSequence analysisAdd BLAST21
Transmembranei183 – 203HelicalSequence analysisAdd BLAST21
Transmembranei211 – 231HelicalSequence analysisAdd BLAST21
Transmembranei273 – 293HelicalSequence analysisAdd BLAST21
Transmembranei317 – 337HelicalSequence analysisAdd BLAST21
Transmembranei341 – 361HelicalSequence analysisAdd BLAST21
Transmembranei363 – 383HelicalSequence analysisAdd BLAST21
Transmembranei405 – 425HelicalSequence analysisAdd BLAST21
Transmembranei442 – 462HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002503871 – 478Sodium-dependent phosphate transport protein 3Add BLAST478

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi28N-linked (GlcNAc...)Sequence analysis1
Glycosylationi47N-linked (GlcNAc...)Sequence analysis1
Glycosylationi56N-linked (GlcNAc...)Sequence analysis1
Glycosylationi69N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ5SZA1.
PeptideAtlasiQ5SZA1.
PRIDEiQ5SZA1.

PTM databases

iPTMnetiQ5SZA1.
PhosphoSitePlusiQ5SZA1.

Expressioni

Gene expression databases

BgeeiENSMUSG00000036110.
GenevisibleiQ5SZA1. MM.

Interactioni

Subunit structurei

Interacts with PDZK1.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000006786.

Structurei

3D structure databases

ProteinModelPortaliQ5SZA1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2532. Eukaryota.
ENOG410XPWC. LUCA.
GeneTreeiENSGT00760000119079.
HOGENOMiHOG000230813.
HOVERGENiHBG008834.
InParanoidiQ5SZA1.
KOiK12300.
OMAiFYIFGST.
OrthoDBiEOG091G080B.
TreeFamiTF313535.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR011701. MFS.
IPR020846. MFS_dom.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5SZA1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEKPTTRKG SGFCSLRYAL ALIMHFSNFT MITQRVSLSI AIIAMVNSTQ
60 70 80 90 100
HQDPANASTE GPVMDLLSNQ SRGIKDFSTR AAVYQWSTET QGIIFSSISY
110 120 130 140 150
GIILTLIPSG YLAGIFGAKQ ILGAGLLISS LLTLFTPLAA DFGVILVIVI
160 170 180 190 200
RTVQGMAQGM AWTGQFTIWA KWAPPLERSK LTSIAGSGAA FGSFIILCVG
210 220 230 240 250
GLISQALGWP FIFYIFGSIG CVCCVLWFTV IYDDPMHHPC ISVREKEHIT
260 270 280 290 300
SSVAQQSSSP RRSVPIKAMV RCLPLWAIFM GFFSHFWLCT IIITYLPTYI
310 320 330 340 350
STVLHVNIRD SGVLSSLPFI AASSCTILGG QMADFLLSRN LLSLITVRKL
360 370 380 390 400
FSSLGLLLPS LCAVALPFVT SSYIATIVLL ILIPGTSNLC DSGFIINTLD
410 420 430 440 450
VAPRYASFLM GISRGFGLTA GIISSTTTGF LISQDSESGW RNVFFLSAAV
460 470
NMFGLIFYLI FGQAEIQSWA KERTLTRL
Length:478
Mass (Da):51,965
Last modified:December 21, 2004 - v1
Checksum:i3E889F0691509CBD
GO
Isoform 2 (identifier: Q5SZA1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     435-478: DSESGWRNVFFLSAAVNMFGLIFYLIFGQAEIQSWAKERTLTRL → VGHVIEHLQVAGF

Show »
Length:447
Mass (Da):48,257
Checksum:i85CC1A5711B5C578
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_020639435 – 478DSESG…TLTRL → VGHVIEHLQVAGF in isoform 2. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL590388 Genomic DNA. Translation: CAI25833.1.
BC018306 mRNA. Translation: AAH18306.1.
CCDSiCCDS36620.1. [Q5SZA1-2]
RefSeqiNP_659085.1. NM_144836.2. [Q5SZA1-2]
XP_006516711.1. XM_006516648.3. [Q5SZA1-1]
XP_006516715.1. XM_006516652.2. [Q5SZA1-2]
UniGeneiMm.24030.

Genome annotation databases

EnsembliENSMUST00000006786; ENSMUSP00000006786; ENSMUSG00000036110. [Q5SZA1-2]
ENSMUST00000099697; ENSMUSP00000097288; ENSMUSG00000036110. [Q5SZA1-1]
GeneIDi218103.
KEGGimmu:218103.
UCSCiuc007pvb.1. mouse. [Q5SZA1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL590388 Genomic DNA. Translation: CAI25833.1.
BC018306 mRNA. Translation: AAH18306.1.
CCDSiCCDS36620.1. [Q5SZA1-2]
RefSeqiNP_659085.1. NM_144836.2. [Q5SZA1-2]
XP_006516711.1. XM_006516648.3. [Q5SZA1-1]
XP_006516715.1. XM_006516652.2. [Q5SZA1-2]
UniGeneiMm.24030.

3D structure databases

ProteinModelPortaliQ5SZA1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000006786.

PTM databases

iPTMnetiQ5SZA1.
PhosphoSitePlusiQ5SZA1.

Proteomic databases

PaxDbiQ5SZA1.
PeptideAtlasiQ5SZA1.
PRIDEiQ5SZA1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000006786; ENSMUSP00000006786; ENSMUSG00000036110. [Q5SZA1-2]
ENSMUST00000099697; ENSMUSP00000097288; ENSMUSG00000036110. [Q5SZA1-1]
GeneIDi218103.
KEGGimmu:218103.
UCSCiuc007pvb.1. mouse. [Q5SZA1-2]

Organism-specific databases

CTDi10246.
MGIiMGI:2443098. Slc17a2.

Phylogenomic databases

eggNOGiKOG2532. Eukaryota.
ENOG410XPWC. LUCA.
GeneTreeiENSGT00760000119079.
HOGENOMiHOG000230813.
HOVERGENiHBG008834.
InParanoidiQ5SZA1.
KOiK12300.
OMAiFYIFGST.
OrthoDBiEOG091G080B.
TreeFamiTF313535.

Miscellaneous databases

ChiTaRSiSlc17a2. mouse.
PROiQ5SZA1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000036110.
GenevisibleiQ5SZA1. MM.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR011701. MFS.
IPR020846. MFS_dom.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNPT3_MOUSE
AccessioniPrimary (citable) accession number: Q5SZA1
Secondary accession number(s): Q8VCX8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: December 21, 2004
Last modified: November 2, 2016
This is version 83 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.