Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium-dependent phosphate transport protein 3

Gene

Slc17a2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Important for the resorption of phosphate by the kidney. May be involved in actively transporting phosphate into cells via Na+ cotransport in the renal brush border membrane (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processIon transport, Sodium transport, Symport, Transport
LigandSodium

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium-dependent phosphate transport protein 3
Alternative name(s):
Na(+)/PI cotransporter 3
Sodium/phosphate cotransporter 3
Solute carrier family 17 member 2
Gene namesi
Name:Slc17a2
Synonyms:Npt3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:2443098 Slc17a2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei98 – 118HelicalSequence analysisAdd BLAST21
Transmembranei130 – 150HelicalSequence analysisAdd BLAST21
Transmembranei183 – 203HelicalSequence analysisAdd BLAST21
Transmembranei211 – 231HelicalSequence analysisAdd BLAST21
Transmembranei273 – 293HelicalSequence analysisAdd BLAST21
Transmembranei317 – 337HelicalSequence analysisAdd BLAST21
Transmembranei341 – 361HelicalSequence analysisAdd BLAST21
Transmembranei363 – 383HelicalSequence analysisAdd BLAST21
Transmembranei405 – 425HelicalSequence analysisAdd BLAST21
Transmembranei442 – 462HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002503871 – 478Sodium-dependent phosphate transport protein 3Add BLAST478

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi28N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi47N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi56N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi69N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ5SZA1
PeptideAtlasiQ5SZA1
PRIDEiQ5SZA1

PTM databases

iPTMnetiQ5SZA1
PhosphoSitePlusiQ5SZA1

Expressioni

Gene expression databases

BgeeiENSMUSG00000036110
GenevisibleiQ5SZA1 MM

Interactioni

Subunit structurei

Interacts with PDZK1.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000006786

Structurei

3D structure databases

ProteinModelPortaliQ5SZA1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2532 Eukaryota
ENOG410XPWC LUCA
GeneTreeiENSGT00760000119079
HOGENOMiHOG000230813
HOVERGENiHBG008834
InParanoidiQ5SZA1
KOiK12300
OMAiGMMINYF
OrthoDBiEOG091G080B
TreeFamiTF313535

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
PfamiView protein in Pfam
PF07690 MFS_1, 1 hit
SUPFAMiSSF103473 SSF103473, 2 hits
PROSITEiView protein in PROSITE
PS50850 MFS, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5SZA1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEKPTTRKG SGFCSLRYAL ALIMHFSNFT MITQRVSLSI AIIAMVNSTQ
60 70 80 90 100
HQDPANASTE GPVMDLLSNQ SRGIKDFSTR AAVYQWSTET QGIIFSSISY
110 120 130 140 150
GIILTLIPSG YLAGIFGAKQ ILGAGLLISS LLTLFTPLAA DFGVILVIVI
160 170 180 190 200
RTVQGMAQGM AWTGQFTIWA KWAPPLERSK LTSIAGSGAA FGSFIILCVG
210 220 230 240 250
GLISQALGWP FIFYIFGSIG CVCCVLWFTV IYDDPMHHPC ISVREKEHIT
260 270 280 290 300
SSVAQQSSSP RRSVPIKAMV RCLPLWAIFM GFFSHFWLCT IIITYLPTYI
310 320 330 340 350
STVLHVNIRD SGVLSSLPFI AASSCTILGG QMADFLLSRN LLSLITVRKL
360 370 380 390 400
FSSLGLLLPS LCAVALPFVT SSYIATIVLL ILIPGTSNLC DSGFIINTLD
410 420 430 440 450
VAPRYASFLM GISRGFGLTA GIISSTTTGF LISQDSESGW RNVFFLSAAV
460 470
NMFGLIFYLI FGQAEIQSWA KERTLTRL
Length:478
Mass (Da):51,965
Last modified:December 21, 2004 - v1
Checksum:i3E889F0691509CBD
GO
Isoform 2 (identifier: Q5SZA1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     435-478: DSESGWRNVFFLSAAVNMFGLIFYLIFGQAEIQSWAKERTLTRL → VGHVIEHLQVAGF

Show »
Length:447
Mass (Da):48,257
Checksum:i85CC1A5711B5C578
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_020639435 – 478DSESG…TLTRL → VGHVIEHLQVAGF in isoform 2. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL590388 Genomic DNA No translation available.
BC018306 mRNA Translation: AAH18306.1
CCDSiCCDS36620.1 [Q5SZA1-2]
RefSeqiNP_659085.1, NM_144836.2 [Q5SZA1-2]
XP_006516711.1, XM_006516648.3 [Q5SZA1-1]
XP_006516715.1, XM_006516652.2 [Q5SZA1-2]
UniGeneiMm.24030

Genome annotation databases

EnsembliENSMUST00000006786; ENSMUSP00000006786; ENSMUSG00000036110 [Q5SZA1-2]
ENSMUST00000099697; ENSMUSP00000097288; ENSMUSG00000036110 [Q5SZA1-1]
GeneIDi218103
KEGGimmu:218103
UCSCiuc007pvb.1 mouse [Q5SZA1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNPT3_MOUSE
AccessioniPrimary (citable) accession number: Q5SZA1
Secondary accession number(s): Q8VCX8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: December 21, 2004
Last modified: March 28, 2018
This is version 90 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health