Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NHS-like protein 1

Gene

NHSL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
NHS-like protein 1
Gene namesi
Name:NHSL1
Synonyms:C6orf63, KIAA1357
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21021. NHSL1.

Pathology & Biotechi

Organism-specific databases

DisGeNETi57224.
OpenTargetsiENSG00000135540.
PharmGKBiPA134929320.

Polymorphism and mutation databases

BioMutaiNHSL1.
DMDMi190360005.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003413531 – 1610NHS-like protein 1Add BLAST1610

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei24PhosphoserineBy similarity1
Modified residuei198PhosphoserineCombined sources1
Modified residuei328PhosphoserineCombined sources1
Modified residuei568PhosphoserineBy similarity1
Modified residuei639PhosphoserineBy similarity1
Modified residuei1089PhosphoserineBy similarity1
Modified residuei1167PhosphoserineCombined sources1
Modified residuei1233PhosphoserineCombined sources1
Modified residuei1386PhosphoserineCombined sources1
Modified residuei1388PhosphoserineCombined sources1
Modified residuei1392PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ5SYE7.
MaxQBiQ5SYE7.
PaxDbiQ5SYE7.
PeptideAtlasiQ5SYE7.
PRIDEiQ5SYE7.

PTM databases

iPTMnetiQ5SYE7.
PhosphoSitePlusiQ5SYE7.

Expressioni

Tissue specificityi

Widely expressed. Expressed in adult and fetal brain, fetal eyes, adult lens, kidney, liver and intestine.1 Publication

Gene expression databases

BgeeiENSG00000135540.
CleanExiHS_NHSL1.
ExpressionAtlasiQ5SYE7. baseline and differential.
GenevisibleiQ5SYE7. HS.

Organism-specific databases

HPAiHPA029966.
HPA029967.
HPA029968.

Interactioni

Protein-protein interaction databases

BioGridi121460. 7 interactors.
DIPiDIP-47303N.
IntActiQ5SYE7. 6 interactors.
STRINGi9606.ENSP00000394546.

Structurei

3D structure databases

ProteinModelPortaliQ5SYE7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi894 – 918Ser-richAdd BLAST25
Compositional biasi926 – 1070Pro-richAdd BLAST145

Sequence similaritiesi

Belongs to the NHS family.Curated

Phylogenomic databases

eggNOGiENOG410IJSF. Eukaryota.
ENOG410XXZ7. LUCA.
GeneTreeiENSGT00530000063248.
HOGENOMiHOG000113783.
HOVERGENiHBG108185.
InParanoidiQ5SYE7.
OMAiYADSWGY.
OrthoDBiEOG091G014K.
PhylomeDBiQ5SYE7.
TreeFamiTF333323.

Family and domain databases

InterProiIPR024845. NHS_fam.
[Graphical view]
PfamiPF15273. NHS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5SYE7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKKEGSSGSF RLQPNTGSLS RAVSWINFSS LSRQTKRLFR SDGELSVCGQ
60 70 80 90 100
QVEVDDENWI YRAQPRKAVS NLDEESRWTV HYTAPWHQQE NVFLPTTRPP
110 120 130 140 150
CVEDLHRQAK LNLKSVLREC DKLRHDGYRS SQYYSQGPTF AANASPFCDD
160 170 180 190 200
YQDEDEETDQ KCSLSSSEEE RFISIRRPKT PASSDFSDLN TQTNWTKSLP
210 220 230 240 250
LPTPEEKMRQ QAQTVQADVV PINITASGTG QDDADGHSVY TPDHYSTLGR
260 270 280 290 300
FNSCRSAGQR SETRDSSCQT EDVKVVPPSM RRIRAQKGQG IAAQMGHFSG
310 320 330 340 350
SSGNMSVLSD SAGIVFPSRL DSDAGFHSLP RSGARANIQS LEPRLGALGP
360 370 380 390 400
AGDMNGTFLY QRGHPQADEN LGHLGGASGT GTLLRPKSQE LRHFESENIM
410 420 430 440 450
SPACVVSPHA TYSTSIIPNA TLSSSSEVIA IPTAQSAGQR ESKSSGSSHA
460 470 480 490 500
RIKSRDHLIS RHAVKGDPQS PGRHWNEGHA TILSQDLDPH SPGEPALLSL
510 520 530 540 550
CDSAVPLNAP ANRENGSQAM PYNCRNNLAF PAHPQDVDGK SESSYSGGGG
560 570 580 590 600
HSSSEPWEYK SSGNGRASPL KPHLATPGYS TPTSNMSSCS LDQTSNKEDA
610 620 630 640 650
GSLYSEDHDG YCASVHTDSG HGSGNLCNSS DGFGNPRHSV INVFVGRAQK
660 670 680 690 700
NQGDRSNYQD KSLSRNISLK KAKKPPLPPS RTDSLRRIPK KSSQCNGQVL
710 720 730 740 750
NESLIATLQH SLQLSLPGKS GSSPSQSPCS DLEEPWLPRS RSQSTVSAGS
760 770 780 790 800
SMTSATTPNV YSLCGATPSQ SDTSSVKSEY TDPWGYYIDY TGMQEDPGNP
810 820 830 840 850
AGGCSTSSGV PTGNGPVRHV QEGSRATMPQ VPGGSVKPKI MSPEKSHRVI
860 870 880 890 900
SPSSGYSSQS NTPTALTPVP VFLKSVSPAN GKGKPKPKVP ERKSSLISSV
910 920 930 940 950
SISSSSTSLS SSTSTEGSGT MKKLDPAVGS PPAPPPPPVP SPPFPCPADR
960 970 980 990 1000
SPFLPPPPPV TDCSQGSPLP HSPVFPPPPP EALIPFCSPP DWCLSPPRPA
1010 1020 1030 1040 1050
LSPILPDSPV SLPLPPPLLP SSEPPPAPPL DPKFMKDTRP PFTNSGQPES
1060 1070 1080 1090 1100
SRGSLRPPST KEETSRPPMP LITTEALQMV QLRPVRKNSG AEAAQLSERT
1110 1120 1130 1140 1150
AQEQRTPVAP QYHLKPSAFL KSRNSTNEME SESQPASVTS SLPTPAKSSS
1160 1170 1180 1190 1200
QGDHGSAAER GGPVSRSPGA PSAGEAEARP SPSTTPLPDS SPSRKPPPIS
1210 1220 1230 1240 1250
KKPKLFLVVP PPQKDFAVEP AENVSEALRA VPSPTTGEEG SVHSREAKES
1260 1270 1280 1290 1300
SAAQAGSHAT HPGTSVLEGG AAGSMSPSRV EANVPMVQPD VSPAPKQEEP
1310 1320 1330 1340 1350
AENSADTGGD GESCLSQQDG AAGVPETNAA GSSSEACDFL KEDGNDEVMT
1360 1370 1380 1390 1400
PSRPRTTEDL FAAIHRSKRK VLGRRDSDDD HSRNHSPSPP VTPTGAAPSL
1410 1420 1430 1440 1450
ASPKQVGSIQ RSIRKSSTSS DNFKALLLKK GSRSDTSARM SAAEMLKNTD
1460 1470 1480 1490 1500
PRFQRSRSEP SPDAPESPSS CSPSKNRRAQ EEWAKNEGLM PRSLSFSGPR
1510 1520 1530 1540 1550
YGRSRTPPSA ASSRYSMRNR IQSSPMTVIS EGEGEAVEPV DSIARGALGA
1560 1570 1580 1590 1600
AEGCSLDGLA REEMDEGGLL CGEGPAASLQ PQAPGPVDGT ASAEGREPSP
1610
QCGGSLSEES
Length:1,610
Mass (Da):170,668
Last modified:June 10, 2008 - v2
Checksum:i1E986A2304C5E4E5
GO
Isoform 2 (identifier: Q5SYE7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MKKEGSSGSF...WIYRAQPRKA → MVVFINAKIKSLIKLFKKKT
     225-225: T → TGENFDRQASLRRSLIYTDTLVRRPKKVKRRKTITGVPDNIQKEL

Show »
Length:1,606
Mass (Da):170,477
Checksum:i6CD70FAD11BAA616
GO

Sequence cautioni

The sequence CAI12098 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI12099 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI14156 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI14157 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1487E → S in AAH45181 (PubMed:15489334).Curated1
Sequence conflicti1608E → K in AAH45181 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0440551085V → M.Corresponds to variant rs3734305dbSNPEnsembl.1
Natural variantiVAR_0440561585G → S.1 PublicationCorresponds to variant rs11540147dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0408181 – 68MKKEG…QPRKA → MVVFINAKIKSLIKLFKKKT in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_040819225T → TGENFDRQASLRRSLIYTDT LVRRPKKVKRRKTITGVPDN IQKEL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK307584 mRNA. No translation available.
AL591375, AL391669 Genomic DNA. Translation: CAI12098.1. Sequence problems.
AL591375, AL391669 Genomic DNA. Translation: CAI12099.1. Sequence problems.
AL391669, AL591375 Genomic DNA. Translation: CAI14156.1. Sequence problems.
AL391669, AL591375 Genomic DNA. Translation: CAI14157.1. Sequence problems.
AB037778 mRNA. Translation: BAA92595.1.
BC045181 mRNA. Translation: AAH45181.1.
CCDSiCCDS47487.1. [Q5SYE7-2]
CCDS55063.1. [Q5SYE7-1]
RefSeqiNP_001137532.1. NM_001144060.1. [Q5SYE7-2]
NP_065197.1. NM_020464.1. [Q5SYE7-1]
UniGeneiHs.652741.

Genome annotation databases

EnsembliENST00000343505; ENSP00000344672; ENSG00000135540. [Q5SYE7-2]
ENST00000427025; ENSP00000394546; ENSG00000135540. [Q5SYE7-1]
GeneIDi57224.
KEGGihsa:57224.
UCSCiuc003qhx.4. human. [Q5SYE7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK307584 mRNA. No translation available.
AL591375, AL391669 Genomic DNA. Translation: CAI12098.1. Sequence problems.
AL591375, AL391669 Genomic DNA. Translation: CAI12099.1. Sequence problems.
AL391669, AL591375 Genomic DNA. Translation: CAI14156.1. Sequence problems.
AL391669, AL591375 Genomic DNA. Translation: CAI14157.1. Sequence problems.
AB037778 mRNA. Translation: BAA92595.1.
BC045181 mRNA. Translation: AAH45181.1.
CCDSiCCDS47487.1. [Q5SYE7-2]
CCDS55063.1. [Q5SYE7-1]
RefSeqiNP_001137532.1. NM_001144060.1. [Q5SYE7-2]
NP_065197.1. NM_020464.1. [Q5SYE7-1]
UniGeneiHs.652741.

3D structure databases

ProteinModelPortaliQ5SYE7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121460. 7 interactors.
DIPiDIP-47303N.
IntActiQ5SYE7. 6 interactors.
STRINGi9606.ENSP00000394546.

PTM databases

iPTMnetiQ5SYE7.
PhosphoSitePlusiQ5SYE7.

Polymorphism and mutation databases

BioMutaiNHSL1.
DMDMi190360005.

Proteomic databases

EPDiQ5SYE7.
MaxQBiQ5SYE7.
PaxDbiQ5SYE7.
PeptideAtlasiQ5SYE7.
PRIDEiQ5SYE7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343505; ENSP00000344672; ENSG00000135540. [Q5SYE7-2]
ENST00000427025; ENSP00000394546; ENSG00000135540. [Q5SYE7-1]
GeneIDi57224.
KEGGihsa:57224.
UCSCiuc003qhx.4. human. [Q5SYE7-1]

Organism-specific databases

CTDi57224.
DisGeNETi57224.
GeneCardsiNHSL1.
HGNCiHGNC:21021. NHSL1.
HPAiHPA029966.
HPA029967.
HPA029968.
neXtProtiNX_Q5SYE7.
OpenTargetsiENSG00000135540.
PharmGKBiPA134929320.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJSF. Eukaryota.
ENOG410XXZ7. LUCA.
GeneTreeiENSGT00530000063248.
HOGENOMiHOG000113783.
HOVERGENiHBG108185.
InParanoidiQ5SYE7.
OMAiYADSWGY.
OrthoDBiEOG091G014K.
PhylomeDBiQ5SYE7.
TreeFamiTF333323.

Miscellaneous databases

ChiTaRSiNHSL1. human.
GenomeRNAii57224.
PROiQ5SYE7.

Gene expression databases

BgeeiENSG00000135540.
CleanExiHS_NHSL1.
ExpressionAtlasiQ5SYE7. baseline and differential.
GenevisibleiQ5SYE7. HS.

Family and domain databases

InterProiIPR024845. NHS_fam.
[Graphical view]
PfamiPF15273. NHS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNHSL1_HUMAN
AccessioniPrimary (citable) accession number: Q5SYE7
Secondary accession number(s): Q3ZCS5, Q5SYE8, Q9P2J0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: November 30, 2016
This is version 91 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.