SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5SYE7

- NHSL1_HUMAN

UniProt

Q5SYE7 - NHSL1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

NHS-like protein 1

Gene
NHSL1, C6orf63, KIAA1357
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
NHS-like protein 1
Gene namesi
Name:NHSL1
Synonyms:C6orf63, KIAA1357
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:21021. NHSL1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134929320.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 16101610NHS-like protein 1PRO_0000341353Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1167 – 11671Phosphoserine1 Publication
Modified residuei1386 – 13861Phosphoserine2 Publications
Modified residuei1388 – 13881Phosphoserine2 Publications
Modified residuei1392 – 13921Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ5SYE7.
PaxDbiQ5SYE7.
PRIDEiQ5SYE7.

PTM databases

PhosphoSiteiQ5SYE7.

Expressioni

Tissue specificityi

Widely expressed. Expressed in adult and fetal brain, fetal eyes, adult lens, kidney, liver and intestine.1 Publication

Gene expression databases

ArrayExpressiQ5SYE7.
BgeeiQ5SYE7.
CleanExiHS_NHSL1.
GenevestigatoriQ5SYE7.

Organism-specific databases

HPAiHPA029966.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000344672.

Structurei

3D structure databases

ProteinModelPortaliQ5SYE7.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi894 – 91825Ser-richAdd
BLAST
Compositional biasi926 – 1070145Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the NHS family.

Phylogenomic databases

eggNOGiNOG40758.
HOGENOMiHOG000113783.
HOVERGENiHBG108185.
OMAiPPQRDFT.
OrthoDBiEOG741Z1J.
PhylomeDBiQ5SYE7.
TreeFamiTF333323.

Family and domain databases

InterProiIPR024845. NHS_fam.
[Graphical view]
PfamiPF15273. NHS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5SYE7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKKEGSSGSF RLQPNTGSLS RAVSWINFSS LSRQTKRLFR SDGELSVCGQ     50
QVEVDDENWI YRAQPRKAVS NLDEESRWTV HYTAPWHQQE NVFLPTTRPP 100
CVEDLHRQAK LNLKSVLREC DKLRHDGYRS SQYYSQGPTF AANASPFCDD 150
YQDEDEETDQ KCSLSSSEEE RFISIRRPKT PASSDFSDLN TQTNWTKSLP 200
LPTPEEKMRQ QAQTVQADVV PINITASGTG QDDADGHSVY TPDHYSTLGR 250
FNSCRSAGQR SETRDSSCQT EDVKVVPPSM RRIRAQKGQG IAAQMGHFSG 300
SSGNMSVLSD SAGIVFPSRL DSDAGFHSLP RSGARANIQS LEPRLGALGP 350
AGDMNGTFLY QRGHPQADEN LGHLGGASGT GTLLRPKSQE LRHFESENIM 400
SPACVVSPHA TYSTSIIPNA TLSSSSEVIA IPTAQSAGQR ESKSSGSSHA 450
RIKSRDHLIS RHAVKGDPQS PGRHWNEGHA TILSQDLDPH SPGEPALLSL 500
CDSAVPLNAP ANRENGSQAM PYNCRNNLAF PAHPQDVDGK SESSYSGGGG 550
HSSSEPWEYK SSGNGRASPL KPHLATPGYS TPTSNMSSCS LDQTSNKEDA 600
GSLYSEDHDG YCASVHTDSG HGSGNLCNSS DGFGNPRHSV INVFVGRAQK 650
NQGDRSNYQD KSLSRNISLK KAKKPPLPPS RTDSLRRIPK KSSQCNGQVL 700
NESLIATLQH SLQLSLPGKS GSSPSQSPCS DLEEPWLPRS RSQSTVSAGS 750
SMTSATTPNV YSLCGATPSQ SDTSSVKSEY TDPWGYYIDY TGMQEDPGNP 800
AGGCSTSSGV PTGNGPVRHV QEGSRATMPQ VPGGSVKPKI MSPEKSHRVI 850
SPSSGYSSQS NTPTALTPVP VFLKSVSPAN GKGKPKPKVP ERKSSLISSV 900
SISSSSTSLS SSTSTEGSGT MKKLDPAVGS PPAPPPPPVP SPPFPCPADR 950
SPFLPPPPPV TDCSQGSPLP HSPVFPPPPP EALIPFCSPP DWCLSPPRPA 1000
LSPILPDSPV SLPLPPPLLP SSEPPPAPPL DPKFMKDTRP PFTNSGQPES 1050
SRGSLRPPST KEETSRPPMP LITTEALQMV QLRPVRKNSG AEAAQLSERT 1100
AQEQRTPVAP QYHLKPSAFL KSRNSTNEME SESQPASVTS SLPTPAKSSS 1150
QGDHGSAAER GGPVSRSPGA PSAGEAEARP SPSTTPLPDS SPSRKPPPIS 1200
KKPKLFLVVP PPQKDFAVEP AENVSEALRA VPSPTTGEEG SVHSREAKES 1250
SAAQAGSHAT HPGTSVLEGG AAGSMSPSRV EANVPMVQPD VSPAPKQEEP 1300
AENSADTGGD GESCLSQQDG AAGVPETNAA GSSSEACDFL KEDGNDEVMT 1350
PSRPRTTEDL FAAIHRSKRK VLGRRDSDDD HSRNHSPSPP VTPTGAAPSL 1400
ASPKQVGSIQ RSIRKSSTSS DNFKALLLKK GSRSDTSARM SAAEMLKNTD 1450
PRFQRSRSEP SPDAPESPSS CSPSKNRRAQ EEWAKNEGLM PRSLSFSGPR 1500
YGRSRTPPSA ASSRYSMRNR IQSSPMTVIS EGEGEAVEPV DSIARGALGA 1550
AEGCSLDGLA REEMDEGGLL CGEGPAASLQ PQAPGPVDGT ASAEGREPSP 1600
QCGGSLSEES 1610
Length:1,610
Mass (Da):170,668
Last modified:June 10, 2008 - v2
Checksum:i1E986A2304C5E4E5
GO
Isoform 2 (identifier: Q5SYE7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MKKEGSSGSF...WIYRAQPRKA → MVVFINAKIKSLIKLFKKKT
     225-225: T → TGENFDRQASLRRSLIYTDTLVRRPKKVKRRKTITGVPDNIQKEL

Show »
Length:1,606
Mass (Da):170,477
Checksum:i6CD70FAD11BAA616
GO

Sequence cautioni

The sequence CAI12098.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAI12099.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAI14156.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAI14157.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1085 – 10851V → M.
Corresponds to variant rs3734305 [ dbSNP | Ensembl ].
VAR_044055
Natural varianti1585 – 15851G → S.1 Publication
Corresponds to variant rs11540147 [ dbSNP | Ensembl ].
VAR_044056

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6868MKKEG…QPRKA → MVVFINAKIKSLIKLFKKKT in isoform 2. VSP_040818Add
BLAST
Alternative sequencei225 – 2251T → TGENFDRQASLRRSLIYTDT LVRRPKKVKRRKTITGVPDN IQKEL in isoform 2. VSP_040819

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1487 – 14871E → S in AAH45181. 1 Publication
Sequence conflicti1608 – 16081E → K in AAH45181. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK307584 mRNA. No translation available.
AL591375, AL391669 Genomic DNA. Translation: CAI12098.1. Sequence problems.
AL591375, AL391669 Genomic DNA. Translation: CAI12099.1. Sequence problems.
AL391669, AL591375 Genomic DNA. Translation: CAI14156.1. Sequence problems.
AL391669, AL591375 Genomic DNA. Translation: CAI14157.1. Sequence problems.
AB037778 mRNA. Translation: BAA92595.1.
BC045181 mRNA. Translation: AAH45181.1.
CCDSiCCDS47487.1. [Q5SYE7-2]
CCDS55063.1. [Q5SYE7-1]
RefSeqiNP_001137532.1. NM_001144060.1. [Q5SYE7-2]
NP_065197.1. NM_020464.1. [Q5SYE7-1]
UniGeneiHs.652741.

Genome annotation databases

EnsembliENST00000343505; ENSP00000344672; ENSG00000135540. [Q5SYE7-2]
ENST00000427025; ENSP00000394546; ENSG00000135540. [Q5SYE7-1]
GeneIDi57224.
KEGGihsa:57224.
UCSCiuc003qhx.3. human. [Q5SYE7-1]
uc011edp.2. human. [Q5SYE7-2]

Polymorphism databases

DMDMi190360005.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK307584 mRNA. No translation available.
AL591375 , AL391669 Genomic DNA. Translation: CAI12098.1 . Sequence problems.
AL591375 , AL391669 Genomic DNA. Translation: CAI12099.1 . Sequence problems.
AL391669 , AL591375 Genomic DNA. Translation: CAI14156.1 . Sequence problems.
AL391669 , AL591375 Genomic DNA. Translation: CAI14157.1 . Sequence problems.
AB037778 mRNA. Translation: BAA92595.1 .
BC045181 mRNA. Translation: AAH45181.1 .
CCDSi CCDS47487.1. [Q5SYE7-2 ]
CCDS55063.1. [Q5SYE7-1 ]
RefSeqi NP_001137532.1. NM_001144060.1. [Q5SYE7-2 ]
NP_065197.1. NM_020464.1. [Q5SYE7-1 ]
UniGenei Hs.652741.

3D structure databases

ProteinModelPortali Q5SYE7.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000344672.

PTM databases

PhosphoSitei Q5SYE7.

Polymorphism databases

DMDMi 190360005.

Proteomic databases

MaxQBi Q5SYE7.
PaxDbi Q5SYE7.
PRIDEi Q5SYE7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000343505 ; ENSP00000344672 ; ENSG00000135540 . [Q5SYE7-2 ]
ENST00000427025 ; ENSP00000394546 ; ENSG00000135540 . [Q5SYE7-1 ]
GeneIDi 57224.
KEGGi hsa:57224.
UCSCi uc003qhx.3. human. [Q5SYE7-1 ]
uc011edp.2. human. [Q5SYE7-2 ]

Organism-specific databases

CTDi 57224.
GeneCardsi GC06M138743.
HGNCi HGNC:21021. NHSL1.
HPAi HPA029966.
neXtProti NX_Q5SYE7.
PharmGKBi PA134929320.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG40758.
HOGENOMi HOG000113783.
HOVERGENi HBG108185.
OMAi PPQRDFT.
OrthoDBi EOG741Z1J.
PhylomeDBi Q5SYE7.
TreeFami TF333323.

Miscellaneous databases

ChiTaRSi NHSL1. human.
GenomeRNAii 57224.
NextBioi 63359.
PROi Q5SYE7.

Gene expression databases

ArrayExpressi Q5SYE7.
Bgeei Q5SYE7.
CleanExi HS_NHSL1.
Genevestigatori Q5SYE7.

Family and domain databases

InterProi IPR024845. NHS_fam.
[Graphical view ]
Pfami PF15273. NHS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  2. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 775-1610.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1487-1610, VARIANT SER-1585.
    Tissue: Brain.
  5. Cited for: IDENTIFICATION, TISSUE SPECIFICITY.
  6. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1167; SER-1386; SER-1388 AND THR-1392, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1386 AND SER-1388, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiNHSL1_HUMAN
AccessioniPrimary (citable) accession number: Q5SYE7
Secondary accession number(s): Q3ZCS5, Q5SYE8, Q9P2J0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: July 9, 2014
This is version 71 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi