Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5SYE7

- NHSL1_HUMAN

UniProt

Q5SYE7 - NHSL1_HUMAN

Protein

NHS-like protein 1

Gene

NHSL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 72 (01 Oct 2014)
      Sequence version 2 (10 Jun 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    NHS-like protein 1
    Gene namesi
    Name:NHSL1
    Synonyms:C6orf63, KIAA1357
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:21021. NHSL1.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134929320.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 16101610NHS-like protein 1PRO_0000341353Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1167 – 11671Phosphoserine1 Publication
    Modified residuei1386 – 13861Phosphoserine2 Publications
    Modified residuei1388 – 13881Phosphoserine2 Publications
    Modified residuei1392 – 13921Phosphothreonine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ5SYE7.
    PaxDbiQ5SYE7.
    PRIDEiQ5SYE7.

    PTM databases

    PhosphoSiteiQ5SYE7.

    Expressioni

    Tissue specificityi

    Widely expressed. Expressed in adult and fetal brain, fetal eyes, adult lens, kidney, liver and intestine.1 Publication

    Gene expression databases

    ArrayExpressiQ5SYE7.
    BgeeiQ5SYE7.
    CleanExiHS_NHSL1.
    GenevestigatoriQ5SYE7.

    Organism-specific databases

    HPAiHPA029966.

    Interactioni

    Protein-protein interaction databases

    IntActiQ5SYE7. 1 interaction.
    STRINGi9606.ENSP00000344672.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5SYE7.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi894 – 91825Ser-richAdd
    BLAST
    Compositional biasi926 – 1070145Pro-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the NHS family.Curated

    Phylogenomic databases

    eggNOGiNOG40758.
    HOGENOMiHOG000113783.
    HOVERGENiHBG108185.
    OMAiPPQRDFT.
    OrthoDBiEOG741Z1J.
    PhylomeDBiQ5SYE7.
    TreeFamiTF333323.

    Family and domain databases

    InterProiIPR024845. NHS_fam.
    [Graphical view]
    PfamiPF15273. NHS. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5SYE7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKKEGSSGSF RLQPNTGSLS RAVSWINFSS LSRQTKRLFR SDGELSVCGQ     50
    QVEVDDENWI YRAQPRKAVS NLDEESRWTV HYTAPWHQQE NVFLPTTRPP 100
    CVEDLHRQAK LNLKSVLREC DKLRHDGYRS SQYYSQGPTF AANASPFCDD 150
    YQDEDEETDQ KCSLSSSEEE RFISIRRPKT PASSDFSDLN TQTNWTKSLP 200
    LPTPEEKMRQ QAQTVQADVV PINITASGTG QDDADGHSVY TPDHYSTLGR 250
    FNSCRSAGQR SETRDSSCQT EDVKVVPPSM RRIRAQKGQG IAAQMGHFSG 300
    SSGNMSVLSD SAGIVFPSRL DSDAGFHSLP RSGARANIQS LEPRLGALGP 350
    AGDMNGTFLY QRGHPQADEN LGHLGGASGT GTLLRPKSQE LRHFESENIM 400
    SPACVVSPHA TYSTSIIPNA TLSSSSEVIA IPTAQSAGQR ESKSSGSSHA 450
    RIKSRDHLIS RHAVKGDPQS PGRHWNEGHA TILSQDLDPH SPGEPALLSL 500
    CDSAVPLNAP ANRENGSQAM PYNCRNNLAF PAHPQDVDGK SESSYSGGGG 550
    HSSSEPWEYK SSGNGRASPL KPHLATPGYS TPTSNMSSCS LDQTSNKEDA 600
    GSLYSEDHDG YCASVHTDSG HGSGNLCNSS DGFGNPRHSV INVFVGRAQK 650
    NQGDRSNYQD KSLSRNISLK KAKKPPLPPS RTDSLRRIPK KSSQCNGQVL 700
    NESLIATLQH SLQLSLPGKS GSSPSQSPCS DLEEPWLPRS RSQSTVSAGS 750
    SMTSATTPNV YSLCGATPSQ SDTSSVKSEY TDPWGYYIDY TGMQEDPGNP 800
    AGGCSTSSGV PTGNGPVRHV QEGSRATMPQ VPGGSVKPKI MSPEKSHRVI 850
    SPSSGYSSQS NTPTALTPVP VFLKSVSPAN GKGKPKPKVP ERKSSLISSV 900
    SISSSSTSLS SSTSTEGSGT MKKLDPAVGS PPAPPPPPVP SPPFPCPADR 950
    SPFLPPPPPV TDCSQGSPLP HSPVFPPPPP EALIPFCSPP DWCLSPPRPA 1000
    LSPILPDSPV SLPLPPPLLP SSEPPPAPPL DPKFMKDTRP PFTNSGQPES 1050
    SRGSLRPPST KEETSRPPMP LITTEALQMV QLRPVRKNSG AEAAQLSERT 1100
    AQEQRTPVAP QYHLKPSAFL KSRNSTNEME SESQPASVTS SLPTPAKSSS 1150
    QGDHGSAAER GGPVSRSPGA PSAGEAEARP SPSTTPLPDS SPSRKPPPIS 1200
    KKPKLFLVVP PPQKDFAVEP AENVSEALRA VPSPTTGEEG SVHSREAKES 1250
    SAAQAGSHAT HPGTSVLEGG AAGSMSPSRV EANVPMVQPD VSPAPKQEEP 1300
    AENSADTGGD GESCLSQQDG AAGVPETNAA GSSSEACDFL KEDGNDEVMT 1350
    PSRPRTTEDL FAAIHRSKRK VLGRRDSDDD HSRNHSPSPP VTPTGAAPSL 1400
    ASPKQVGSIQ RSIRKSSTSS DNFKALLLKK GSRSDTSARM SAAEMLKNTD 1450
    PRFQRSRSEP SPDAPESPSS CSPSKNRRAQ EEWAKNEGLM PRSLSFSGPR 1500
    YGRSRTPPSA ASSRYSMRNR IQSSPMTVIS EGEGEAVEPV DSIARGALGA 1550
    AEGCSLDGLA REEMDEGGLL CGEGPAASLQ PQAPGPVDGT ASAEGREPSP 1600
    QCGGSLSEES 1610
    Length:1,610
    Mass (Da):170,668
    Last modified:June 10, 2008 - v2
    Checksum:i1E986A2304C5E4E5
    GO
    Isoform 2 (identifier: Q5SYE7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-68: MKKEGSSGSF...WIYRAQPRKA → MVVFINAKIKSLIKLFKKKT
         225-225: T → TGENFDRQASLRRSLIYTDTLVRRPKKVKRRKTITGVPDNIQKEL

    Show »
    Length:1,606
    Mass (Da):170,477
    Checksum:i6CD70FAD11BAA616
    GO

    Sequence cautioni

    The sequence CAI12098.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAI12099.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAI14156.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAI14157.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1487 – 14871E → S in AAH45181. (PubMed:15489334)Curated
    Sequence conflicti1608 – 16081E → K in AAH45181. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti1085 – 10851V → M.
    Corresponds to variant rs3734305 [ dbSNP | Ensembl ].
    VAR_044055
    Natural varianti1585 – 15851G → S.1 Publication
    Corresponds to variant rs11540147 [ dbSNP | Ensembl ].
    VAR_044056

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6868MKKEG…QPRKA → MVVFINAKIKSLIKLFKKKT in isoform 2. 1 PublicationVSP_040818Add
    BLAST
    Alternative sequencei225 – 2251T → TGENFDRQASLRRSLIYTDT LVRRPKKVKRRKTITGVPDN IQKEL in isoform 2. 1 PublicationVSP_040819

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK307584 mRNA. No translation available.
    AL591375, AL391669 Genomic DNA. Translation: CAI12098.1. Sequence problems.
    AL591375, AL391669 Genomic DNA. Translation: CAI12099.1. Sequence problems.
    AL391669, AL591375 Genomic DNA. Translation: CAI14156.1. Sequence problems.
    AL391669, AL591375 Genomic DNA. Translation: CAI14157.1. Sequence problems.
    AB037778 mRNA. Translation: BAA92595.1.
    BC045181 mRNA. Translation: AAH45181.1.
    CCDSiCCDS47487.1. [Q5SYE7-2]
    CCDS55063.1. [Q5SYE7-1]
    RefSeqiNP_001137532.1. NM_001144060.1. [Q5SYE7-2]
    NP_065197.1. NM_020464.1. [Q5SYE7-1]
    UniGeneiHs.652741.

    Genome annotation databases

    EnsembliENST00000343505; ENSP00000344672; ENSG00000135540. [Q5SYE7-2]
    ENST00000427025; ENSP00000394546; ENSG00000135540. [Q5SYE7-1]
    GeneIDi57224.
    KEGGihsa:57224.
    UCSCiuc003qhx.3. human. [Q5SYE7-1]
    uc011edp.2. human. [Q5SYE7-2]

    Polymorphism databases

    DMDMi190360005.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK307584 mRNA. No translation available.
    AL591375 , AL391669 Genomic DNA. Translation: CAI12098.1 . Sequence problems.
    AL591375 , AL391669 Genomic DNA. Translation: CAI12099.1 . Sequence problems.
    AL391669 , AL591375 Genomic DNA. Translation: CAI14156.1 . Sequence problems.
    AL391669 , AL591375 Genomic DNA. Translation: CAI14157.1 . Sequence problems.
    AB037778 mRNA. Translation: BAA92595.1 .
    BC045181 mRNA. Translation: AAH45181.1 .
    CCDSi CCDS47487.1. [Q5SYE7-2 ]
    CCDS55063.1. [Q5SYE7-1 ]
    RefSeqi NP_001137532.1. NM_001144060.1. [Q5SYE7-2 ]
    NP_065197.1. NM_020464.1. [Q5SYE7-1 ]
    UniGenei Hs.652741.

    3D structure databases

    ProteinModelPortali Q5SYE7.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q5SYE7. 1 interaction.
    STRINGi 9606.ENSP00000344672.

    PTM databases

    PhosphoSitei Q5SYE7.

    Polymorphism databases

    DMDMi 190360005.

    Proteomic databases

    MaxQBi Q5SYE7.
    PaxDbi Q5SYE7.
    PRIDEi Q5SYE7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000343505 ; ENSP00000344672 ; ENSG00000135540 . [Q5SYE7-2 ]
    ENST00000427025 ; ENSP00000394546 ; ENSG00000135540 . [Q5SYE7-1 ]
    GeneIDi 57224.
    KEGGi hsa:57224.
    UCSCi uc003qhx.3. human. [Q5SYE7-1 ]
    uc011edp.2. human. [Q5SYE7-2 ]

    Organism-specific databases

    CTDi 57224.
    GeneCardsi GC06M138743.
    HGNCi HGNC:21021. NHSL1.
    HPAi HPA029966.
    neXtProti NX_Q5SYE7.
    PharmGKBi PA134929320.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG40758.
    HOGENOMi HOG000113783.
    HOVERGENi HBG108185.
    OMAi PPQRDFT.
    OrthoDBi EOG741Z1J.
    PhylomeDBi Q5SYE7.
    TreeFami TF333323.

    Miscellaneous databases

    ChiTaRSi NHSL1. human.
    GenomeRNAii 57224.
    NextBioi 63359.
    PROi Q5SYE7.

    Gene expression databases

    ArrayExpressi Q5SYE7.
    Bgeei Q5SYE7.
    CleanExi HS_NHSL1.
    Genevestigatori Q5SYE7.

    Family and domain databases

    InterProi IPR024845. NHS_fam.
    [Graphical view ]
    Pfami PF15273. NHS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    2. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
      DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 775-1610.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1487-1610, VARIANT SER-1585.
      Tissue: Brain.
    5. Cited for: IDENTIFICATION, TISSUE SPECIFICITY.
    6. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1167; SER-1386; SER-1388 AND THR-1392, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1386 AND SER-1388, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiNHSL1_HUMAN
    AccessioniPrimary (citable) accession number: Q5SYE7
    Secondary accession number(s): Q3ZCS5, Q5SYE8, Q9P2J0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 10, 2008
    Last sequence update: June 10, 2008
    Last modified: October 1, 2014
    This is version 72 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3