Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gametogenetin-binding protein 2

Gene

Ggnbp2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in spermatogenesis.

GO - Biological processi

  • cell differentiation Source: MGI
  • labyrinthine layer blood vessel development Source: MGI
  • labyrinthine layer development Source: MGI
  • negative regulation of cell proliferation Source: MGI
  • negative regulation of gene expression Source: MGI
  • negative regulation of peptidyl-serine phosphorylation of STAT protein Source: MGI
  • negative regulation of protein tyrosine kinase activity Source: MGI
  • negative regulation of tyrosine phosphorylation of STAT protein Source: MGI
  • spermatogenesis Source: UniProtKB-KW

Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Gametogenetin-binding protein 2
Alternative name(s):
Dioxin-inducible factor 3
Short name:
DIF-3
Protein ZNF403
Gene namesi
Name:Ggnbp2
Synonyms:Zfp403, Znf403
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:2387356. Ggnbp2.

Subcellular locationi

  • Cytoplasmic vesicle 1 Publication

  • Note: Associated with vesicular structures.

GO - Cellular componenti

  • cytoplasm Source: MGI
  • cytoplasmic vesicle Source: UniProtKB-KW
  • nucleus Source: MGI

Keywords - Cellular componenti

Cytoplasmic vesicle

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002393491 – 696Gametogenetin-binding protein 2Add BLAST696

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei360PhosphoserineBy similarity1
Modified residuei602PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ5SV77.
PaxDbiQ5SV77.
PRIDEiQ5SV77.

PTM databases

iPTMnetiQ5SV77.
PhosphoSitePlusiQ5SV77.

Expressioni

Tissue specificityi

Testis-specific.1 Publication

Developmental stagei

Abundantly expressed during spermatogenesis. Not detected in newborn animals, in which spermatogenesis has not yet progressed beyond the earliest stages.

Inductioni

By dioxin (2,3,7,8-Tetrachlorodibenzo-p-dioxin).1 Publication

Gene expression databases

BgeeiENSMUSG00000020530.
CleanExiMM_GGNBP2.
ExpressionAtlasiQ5SV77. baseline and differential.
GenevisibleiQ5SV77. MM.

Interactioni

Subunit structurei

Interacts with isoform 1 of GGN.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
GgnQ80WJ13EBI-4370069,EBI-3890505

Protein-protein interaction databases

IntActiQ5SV77. 2 interactors.
MINTiMINT-1215939.
STRINGi10090.ENSMUSP00000103716.

Structurei

3D structure databases

SMRiQ5SV77.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IEAD. Eukaryota.
ENOG410XRSX. LUCA.
GeneTreeiENSGT00390000009552.
HOVERGENiHBG082524.
InParanoidiQ5SV77.
OMAiRHSMLKQ.
OrthoDBiEOG091G033L.
PhylomeDBiQ5SV77.
TreeFamiTF323487.

Family and domain databases

InterProiView protein in InterPro
IPR026073. GGNBP2.
PANTHERiPTHR13601:SF3. PTHR13601:SF3. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5SV77-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARLVAVCRD GEEEFPFERR QIPLYIDDTL TMVMEFPDNV LNLDGHQNNG
60 70 80 90 100
AQLKQFIQRH SMLKQQDLSI AMVVTSREVL SALSQLVPCV GCRRSVERLF
110 120 130 140 150
SQLVESGNPA LEPLTVGPKG VLSLTRSCMT DAKKLYTLFY VHGSKLNDMI
160 170 180 190 200
DAIPKSKKNK RCQLHSLDTH KPKPLGGCWM DVWELMSQEC RDEVVLIDSS
210 220 230 240 250
CLLETLETYL RKHRFCTDCK NKVLRAYNIL IGELDCSKEK GYCAALYEGL
260 270 280 290 300
RCCPHERHIH VCCETDFIAH LLGRAEPEFA GGRRERHAKT IDIAQEEVLT
310 320 330 340 350
CLGIHLYERL HRIWQKLRAE EQTWQMLFYL GVDALRKSFE MTVEKVQGIS
360 370 380 390 400
RLEQLCEEFS EEERVRELKQ EKKRQKRKNR RKNKCVCDTP ASLHTADEKA
410 420 430 440 450
VSREKETDFI ENSCNACGSA EDGETCVEVM VTSENTSCTC PSSGNLLGSP
460 470 480 490 500
KIKKGMSPHC NGSDCGYSSS MEGSETGSRE GSDVACTEGI CNHDEHGEDS
510 520 530 540 550
CVHHCEDKED DGDSCVECWA NSEENNIKGK NKKKKKKSKM LKCDEHIQKL
560 570 580 590 600
GSCITDPGNR ETSGNTMHTV FHRDKTKDAH PESCCSTEKG GQPLPWFEHR
610 620 630 640 650
KSVPQFTEPT EMSFGPDSGK GAKSLVELLD ESECTSDEEI FISQDEIQSF
660 670 680 690
MANNQSFYSN REQYRQHLKE KFNKYCRLND HKRPVCSGWL TTAGAN
Length:696
Mass (Da):78,970
Last modified:December 21, 2004 - v1
Checksum:iC4F3976169B8646C
GO
Isoform 2 (identifier: Q5SV77-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     282-282: G → GYE

Show »
Length:698
Mass (Da):79,263
Checksum:iB7849F855B077C7C
GO
Isoform 3 (identifier: Q5SV77-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-176: G → GEGSSSSVSSEKLSTDKRSSEDHRKDSKCRIIFHYGPFQGTAR
     282-282: G → GYE

Show »
Length:740
Mass (Da):83,947
Checksum:iA9AC4BF9AEE32ABA
GO
Isoform 4 (identifier: Q5SV77-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-176: G → GEGSSSSVSSEKLSTDKRSSEDHRKDSKCRIIFHYGPFQGTAR

Show »
Length:738
Mass (Da):83,654
Checksum:iE08F62853F7E7281
GO

Sequence cautioni

The sequence AAH60738 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence CAI24983 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI25484 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI25487 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti510D → N in AAI45606 (PubMed:15489334).Curated1
Sequence conflicti510D → N in AAI50802 (PubMed:15489334).Curated1
Isoform 3 (identifier: Q5SV77-3)
Sequence conflicti219G → GG in BAB71783 (PubMed:11728448).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019179176G → GEGSSSSVSSEKLSTDKRSS EDHRKDSKCRIIFHYGPFQG TAR in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_019180282G → GYE in isoform 2 and isoform 3. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB064543 mRNA. Translation: BAB71783.1.
AY633741 mRNA. Translation: AAT47120.1.
AL596083, AL645623 Genomic DNA. Translation: CAI24981.1.
AL596083, AL645623 Genomic DNA. Translation: CAI24982.1.
AL596083, AL645623 Genomic DNA. Translation: CAI24983.1. Sequence problems.
AL645623 Genomic DNA. Translation: CAI25484.1. Sequence problems.
AL645623, AL596083 Genomic DNA. Translation: CAI25485.1.
AL645623, AL596083 Genomic DNA. Translation: CAI25486.1.
AL645623, AL596083 Genomic DNA. Translation: CAI25487.1. Sequence problems.
BC060738 mRNA. Translation: AAH60738.1. Sequence problems.
BC139772 mRNA. Translation: AAI39773.1.
BC145605 mRNA. Translation: AAI45606.1.
BC150801 mRNA. Translation: AAI50802.1.
CCDSiCCDS36262.1. [Q5SV77-2]
RefSeqiNP_694784.2. NM_153144.2. [Q5SV77-2]
XP_011247235.1. XM_011248933.2. [Q5SV77-1]
XP_017169962.1. XM_017314473.1. [Q5SV77-2]
XP_017169963.1. XM_017314474.1. [Q5SV77-1]
XP_017169964.1. XM_017314475.1. [Q5SV77-1]
UniGeneiMm.356653.

Genome annotation databases

EnsembliENSMUST00000018547; ENSMUSP00000018547; ENSMUSG00000020530. [Q5SV77-4]
ENSMUST00000108081; ENSMUSP00000103716; ENSMUSG00000020530. [Q5SV77-2]
ENSMUST00000154915; ENSMUSP00000117482; ENSMUSG00000020530. [Q5SV77-1]
ENSMUST00000168434; ENSMUSP00000130013; ENSMUSG00000020530. [Q5SV77-1]
ENSMUST00000172405; ENSMUSP00000127584; ENSMUSG00000020530. [Q5SV77-2]
GeneIDi217039.
KEGGimmu:217039.
UCSCiuc007kqu.1. mouse. [Q5SV77-1]
uc007kqv.1. mouse. [Q5SV77-2]
uc011ybk.1. mouse. [Q5SV77-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiGGNB2_MOUSE
AccessioniPrimary (citable) accession number: Q5SV77
Secondary accession number(s): A4QPD5
, B7ZP33, Q5SV75, Q5SV76, Q5SV78, Q6GVH6, Q6P9J4, Q920N4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: December 21, 2004
Last modified: July 5, 2017
This is version 92 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot