Q5SUF2 (LC7L3_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 68.
History...
Clusters with 
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Luc7-like protein 3 Alternative name(s): Cisplatin resistance-associated-overexpressed protein | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 432 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing By similarity. |
| Subunit structure | May interact with SFRS1 and form homodimers. Interacts with JMJD6 and RBM25. Interacts with RSRC1 (via Arg/Ser-rich domain) By similarity. |
| Subcellular location | Nucleus speckle By similarity. |
| Sequence similarities | Belongs to the Luc7 family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5SUF2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5SUF2-2) The sequence of this isoform differs from the canonical sequence as follows: 427-432: GDTQSN → VQRKYAQMKMELSRVRRHTKASSEGKDSVVLQNILRYIVLSQLFCSRLRAPISVPLWKLLSTYVI | ||||||
| Isoform 3 (identifier: Q5SUF2-3) The sequence of this isoform differs from the canonical sequence as follows: 427-432: GDTQSN → VQRKYAQMKMELSRVRRHTKASSEGKDSVVLQNILRTTVEEFLKNTENGIK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 432 | 432 | Luc7-like protein 3 | PRO_0000233411 | |||||
Regions | |||||||||
| Coiled coil | 124 – 181 | 58 | Potential | ||||||
| Compositional bias | 228 – 282 | 55 | Glu-rich | ||||||
| Compositional bias | 235 – 395 | 161 | Arg/Ser-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine By similarity | ||||||
| Modified residue | 3 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 110 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 231 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 420 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 425 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 431 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 427 – 432 | 6 | GDTQSN → VQRKYAQMKMELSRVRRHTK ASSEGKDSVVLQNILRYIVL SQLFCSRLRAPISVPLWKLL STYVI in isoform 2. | VSP_018138 | |||||
| Alternative sequence | 427 – 432 | 6 | GDTQSN → VQRKYAQMKMELSRVRRHTK ASSEGKDSVVLQNILRTTVE EFLKNTENGIK in isoform 3. | VSP_018139 | |||||
Experimental info | |||||||||
| Sequence conflict | 402 | 1 | D → E in BAC39261. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.  Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-252 (ISOFORMS 1/2/3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 165-432 (ISOFORM 1). Strain: C57BL/6J. Tissue: Embryonic head, Embryonic heart, Macrophage and Placenta. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: FVB/N. Tissue: Mammary tumor. |
| [4] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-425 AND SER-431, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK014362 mRNA. Translation: BAB29297.1. AK019464 mRNA. Translation: BAB31736.1. AK084714 mRNA. Translation: BAC39261.1. AK151228 mRNA. Translation: BAE30220.1. AK151839 mRNA. Translation: BAE30732.1. AL645846, AL645965 Genomic DNA. Translation: CAI24700.1. AL645846, AL645965 Genomic DNA. Translation: CAI24701.1. AL645965, AL645846 Genomic DNA. Translation: CAI25943.1. AL645965, AL645846 Genomic DNA. Translation: CAI25944.1. BC009092 mRNA. Translation: AAH09092.1. |
| IPI | IPI00122418. IPI00649422. IPI00752942. |
| RefSeq | NP_080589.1. NM_026313.1. |
| UniGene | Mm.30927. |
3D structure databases | |
| ProteinModelPortal | Q5SUF2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5SUF2. 2 interactions. |
| MINT | MINT-1549603. |
PTM databases | |
| PhosphoSite | Q5SUF2. |
Proteomic databases | |
| PaxDb | Q5SUF2. |
| PRIDE | Q5SUF2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000021226; ENSMUSP00000021226; ENSMUSG00000020863. ENSMUST00000107820; ENSMUSP00000103450; ENSMUSG00000020863. ENSMUST00000107821; ENSMUSP00000103451; ENSMUSG00000020863. ENSMUST00000166312; ENSMUSP00000129919; ENSMUSG00000020863. |
| GeneID | 67684. |
| KEGG | mmu:67684. |
| UCSC | uc007kyh.1. mouse. uc007kyi.1. mouse. uc007kyj.1. mouse. |
Organism-specific databases | |
| CTD | 51747. |
| MGI | MGI:1914934. Luc7l3. |
Phylogenomic databases | |
| eggNOG | COG5200. |
| GeneTree | ENSGT00700000104035. |
| HOGENOM | HOG000215956. |
| HOVERGEN | HBG062167. |
| OMA | ISVPLWK. |
| OrthoDB | EOG4QJRNZ. |
Gene expression databases | |
| ArrayExpress | Q5SUF2. |
| Bgee | Q5SUF2. |
| CleanEx | MM_3300001P08RIK. |
| Genevestigator | Q5SUF2. |
| GermOnline | ENSMUSG00000020863. Mus musculus. |
Family and domain databases | |
| InterPro | IPR004882. LUC7-rel. [Graphical view] |
| PANTHER | PTHR12375. PTHR12375. 1 hit. |
| Pfam | PF03194. LUC7. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | LUC7L3. mouse. |
| NextBio | 325251. |
| SOURCE | Search... |
Entry information
| Entry name | LC7L3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q5SUF2 Secondary accession number(s): Q3U9D5 Q9CTY4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |