Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Luc7-like protein 3

Gene

Luc7l3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

mRNA processing, mRNA splicing

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Luc7-like protein 3
Alternative name(s):
Cisplatin resistance-associated-overexpressed protein
Gene namesi
Name:Luc7l3
Synonyms:Crop
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1914934. Luc7l3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 432432Luc7-like protein 3PRO_0000233411Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei3 – 31PhosphoserineBy similarity
Modified residuei110 – 1101PhosphoserineBy similarity
Modified residuei231 – 2311N6-acetyllysineBy similarity
Modified residuei420 – 4201PhosphoserineCombined sources
Modified residuei425 – 4251PhosphoserineCombined sources
Modified residuei431 – 4311PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ5SUF2.
MaxQBiQ5SUF2.
PaxDbiQ5SUF2.
PRIDEiQ5SUF2.

PTM databases

iPTMnetiQ5SUF2.
PhosphoSiteiQ5SUF2.

Expressioni

Gene expression databases

BgeeiQ5SUF2.
CleanExiMM_3300001P08RIK.
ExpressionAtlasiQ5SUF2. baseline and differential.
GenevisibleiQ5SUF2. MM.

Interactioni

Subunit structurei

May interact with SFRS1 and form homodimers. Interacts with JMJD6 and RBM25. Interacts with RSRC1 (via Arg/Ser-rich domain) (By similarity).By similarity

Protein-protein interaction databases

BioGridi212365. 3 interactions.
IntActiQ5SUF2. 2 interactions.
MINTiMINT-1549603.
STRINGi10090.ENSMUSP00000021226.

Structurei

3D structure databases

ProteinModelPortaliQ5SUF2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili124 – 18158Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi228 – 28255Glu-richAdd
BLAST
Compositional biasi235 – 395161Arg/Ser-richAdd
BLAST

Sequence similaritiesi

Belongs to the Luc7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0796. Eukaryota.
COG5200. LUCA.
GeneTreeiENSGT00730000110670.
HOGENOMiHOG000215956.
HOVERGENiHBG062167.
InParanoidiQ5SUF2.
OMAiSQLFCSR.
OrthoDBiEOG78H3TX.
PhylomeDBiQ5SUF2.
TreeFamiTF354312.

Family and domain databases

InterProiIPR004882. Luc7-rel.
[Graphical view]
PANTHERiPTHR12375. PTHR12375. 1 hit.
PfamiPF03194. LUC7. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5SUF2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MISAAQLLDE LMGRDRNLAP DEKRSNVRWD HESVCKYYLC GFCPAELFTN
60 70 80 90 100
TRSDLGPCEK IHDENLRKQY EKSSRFMKVG YERDFLRYLQ SLLAEVERRI
110 120 130 140 150
RRGHARLALS QNQQSSGAAG PTGKNEEKIQ VLTDKIDVLL QQIEELGSEG
160 170 180 190 200
KVEEAQGMMK LVEQLKEERE LLRSTTSTIE SFAAQEKQME VCEVCGAFLI
210 220 230 240 250
VGDAQSRVDD HLMGKQHMGY AKIKATVEEL KEKLRKRTEE PDRDERLKKE
260 270 280 290 300
KQEREEREKE REREREERER KRRREEEERE KERARDRERR KRSRSRSRHS
310 320 330 340 350
SRTSDRRCSR SRDHKRSRSR DRRRSRSRDR RRSRSHDRSE RKHRSRSRDR
360 370 380 390 400
RRSKSRDRKS YKHRSKSRDR EQDRKSKEKE KKGSDDKKSS VKSSSREKQS
410 420 430
EDTNPESKES DTKNEVNGTS EDIKSEGDTQ SN
Length:432
Mass (Da):51,450
Last modified:December 21, 2004 - v1
Checksum:i2546F0AE9A0CC160
GO
Isoform 2 (identifier: Q5SUF2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     427-432: GDTQSN → VQRKYAQMKMELSRVRRHTKASSEGKDSVVLQNILRYIVLSQLFCSRLRAPISVPLWKLLSTYVI

Show »
Length:491
Mass (Da):58,436
Checksum:iC51A22CF78055CE7
GO
Isoform 3 (identifier: Q5SUF2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     427-432: GDTQSN → VQRKYAQMKMELSRVRRHTKASSEGKDSVVLQNILRTTVEEFLKNTENGIK

Show »
Length:477
Mass (Da):56,778
Checksum:i84FE7F03C5B58211
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti402 – 4021D → E in BAC39261 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei427 – 4326GDTQSN → VQRKYAQMKMELSRVRRHTK ASSEGKDSVVLQNILRYIVL SQLFCSRLRAPISVPLWKLL STYVI in isoform 2. 1 PublicationVSP_018138
Alternative sequencei427 – 4326GDTQSN → VQRKYAQMKMELSRVRRHTK ASSEGKDSVVLQNILRTTVE EFLKNTENGIK in isoform 3. 1 PublicationVSP_018139

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK014362 mRNA. Translation: BAB29297.1.
AK019464 mRNA. Translation: BAB31736.1.
AK084714 mRNA. Translation: BAC39261.1.
AK151228 mRNA. Translation: BAE30220.1.
AK151839 mRNA. Translation: BAE30732.1.
AL645846, AL645965 Genomic DNA. Translation: CAI24700.1.
AL645846, AL645965 Genomic DNA. Translation: CAI24701.1.
AL645965, AL645846 Genomic DNA. Translation: CAI25943.1.
AL645965, AL645846 Genomic DNA. Translation: CAI25944.1.
BC009092 mRNA. Translation: AAH09092.1.
CCDSiCCDS25252.1. [Q5SUF2-2]
RefSeqiNP_080589.1. NM_026313.1. [Q5SUF2-2]
XP_006534073.1. XM_006534010.2. [Q5SUF2-1]
XP_006534074.1. XM_006534011.2. [Q5SUF2-1]
XP_011247494.1. XM_011249192.1. [Q5SUF2-3]
UniGeneiMm.30927.

Genome annotation databases

EnsembliENSMUST00000021226; ENSMUSP00000021226; ENSMUSG00000020863. [Q5SUF2-2]
ENSMUST00000107820; ENSMUSP00000103450; ENSMUSG00000020863. [Q5SUF2-1]
ENSMUST00000107821; ENSMUSP00000103451; ENSMUSG00000020863. [Q5SUF2-1]
ENSMUST00000166312; ENSMUSP00000129919; ENSMUSG00000020863. [Q5SUF2-3]
GeneIDi67684.
KEGGimmu:67684.
UCSCiuc007kyh.1. mouse. [Q5SUF2-2]
uc007kyi.1. mouse. [Q5SUF2-1]
uc007kyj.1. mouse. [Q5SUF2-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK014362 mRNA. Translation: BAB29297.1.
AK019464 mRNA. Translation: BAB31736.1.
AK084714 mRNA. Translation: BAC39261.1.
AK151228 mRNA. Translation: BAE30220.1.
AK151839 mRNA. Translation: BAE30732.1.
AL645846, AL645965 Genomic DNA. Translation: CAI24700.1.
AL645846, AL645965 Genomic DNA. Translation: CAI24701.1.
AL645965, AL645846 Genomic DNA. Translation: CAI25943.1.
AL645965, AL645846 Genomic DNA. Translation: CAI25944.1.
BC009092 mRNA. Translation: AAH09092.1.
CCDSiCCDS25252.1. [Q5SUF2-2]
RefSeqiNP_080589.1. NM_026313.1. [Q5SUF2-2]
XP_006534073.1. XM_006534010.2. [Q5SUF2-1]
XP_006534074.1. XM_006534011.2. [Q5SUF2-1]
XP_011247494.1. XM_011249192.1. [Q5SUF2-3]
UniGeneiMm.30927.

3D structure databases

ProteinModelPortaliQ5SUF2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi212365. 3 interactions.
IntActiQ5SUF2. 2 interactions.
MINTiMINT-1549603.
STRINGi10090.ENSMUSP00000021226.

PTM databases

iPTMnetiQ5SUF2.
PhosphoSiteiQ5SUF2.

Proteomic databases

EPDiQ5SUF2.
MaxQBiQ5SUF2.
PaxDbiQ5SUF2.
PRIDEiQ5SUF2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000021226; ENSMUSP00000021226; ENSMUSG00000020863. [Q5SUF2-2]
ENSMUST00000107820; ENSMUSP00000103450; ENSMUSG00000020863. [Q5SUF2-1]
ENSMUST00000107821; ENSMUSP00000103451; ENSMUSG00000020863. [Q5SUF2-1]
ENSMUST00000166312; ENSMUSP00000129919; ENSMUSG00000020863. [Q5SUF2-3]
GeneIDi67684.
KEGGimmu:67684.
UCSCiuc007kyh.1. mouse. [Q5SUF2-2]
uc007kyi.1. mouse. [Q5SUF2-1]
uc007kyj.1. mouse. [Q5SUF2-3]

Organism-specific databases

CTDi51747.
MGIiMGI:1914934. Luc7l3.

Phylogenomic databases

eggNOGiKOG0796. Eukaryota.
COG5200. LUCA.
GeneTreeiENSGT00730000110670.
HOGENOMiHOG000215956.
HOVERGENiHBG062167.
InParanoidiQ5SUF2.
OMAiSQLFCSR.
OrthoDBiEOG78H3TX.
PhylomeDBiQ5SUF2.
TreeFamiTF354312.

Miscellaneous databases

ChiTaRSiLuc7l3. mouse.
NextBioi325251.
PROiQ5SUF2.
SOURCEiSearch...

Gene expression databases

BgeeiQ5SUF2.
CleanExiMM_3300001P08RIK.
ExpressionAtlasiQ5SUF2. baseline and differential.
GenevisibleiQ5SUF2. MM.

Family and domain databases

InterProiIPR004882. Luc7-rel.
[Graphical view]
PANTHERiPTHR12375. PTHR12375. 1 hit.
PfamiPF03194. LUC7. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-252 (ISOFORMS 1/2/3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 165-432 (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Embryonic head, Embryonic heart, Macrophage and Placenta.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: FVB/N.
    Tissue: Mammary tumor.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-425 AND SER-431, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-420; SER-425 AND SER-431, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiLC7L3_MOUSE
AccessioniPrimary (citable) accession number: Q5SUF2
Secondary accession number(s): Q3U9D5
, Q8BUJ5, Q921Z3, Q9CRS7, Q9CTY4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: December 21, 2004
Last modified: May 11, 2016
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.