Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5ST30

- SYVM_HUMAN

UniProt

Q5ST30 - SYVM_HUMAN

Protein

Valine--tRNA ligase, mitochondrial

Gene

VARS2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 2 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    ATP + L-valine + tRNA(Val) = AMP + diphosphate + L-valyl-tRNA(Val).

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei661 – 6611ATPBy similarity

    GO - Molecular functioni

    1. aminoacyl-tRNA editing activity Source: InterPro
    2. ATP binding Source: UniProtKB-KW
    3. valine-tRNA ligase activity Source: UniProtKB-EC

    GO - Biological processi

    1. gene expression Source: Reactome
    2. tRNA aminoacylation for protein translation Source: Reactome
    3. valyl-tRNA aminoacylation Source: InterPro

    Keywords - Molecular functioni

    Aminoacyl-tRNA synthetase, Ligase

    Keywords - Biological processi

    Protein biosynthesis

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_15302. Mitochondrial tRNA aminoacylation.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Valine--tRNA ligase, mitochondrial (EC:6.1.1.9)
    Alternative name(s):
    Valyl-tRNA synthetase
    Short name:
    ValRS
    Valyl-tRNA synthetase-like
    Gene namesi
    Name:VARS2
    Synonyms:KIAA1885, VARS2L, VARSL
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:21642. VARS2.

    Subcellular locationi

    GO - Cellular componenti

    1. mitochondrion Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Mitochondrion

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164742816.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 2626MitochondrionSequence AnalysisAdd
    BLAST
    Chaini27 – 10631037Valine--tRNA ligase, mitochondrialPRO_0000338000Add
    BLAST

    Proteomic databases

    MaxQBiQ5ST30.
    PaxDbiQ5ST30.
    PRIDEiQ5ST30.

    PTM databases

    PhosphoSiteiQ5ST30.

    Expressioni

    Gene expression databases

    ArrayExpressiQ5ST30.
    BgeeiQ5ST30.
    CleanExiHS_VARS2.
    GenevestigatoriQ5ST30.

    Interactioni

    Protein-protein interaction databases

    BioGridi121426. 4 interactions.
    IntActiQ5ST30. 2 interactions.
    MINTiMINT-8052670.
    STRINGi9606.ENSP00000408337.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5ST30.
    SMRiQ5ST30. Positions 100-945.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi146 – 15611"HIGH" regionAdd
    BLAST
    Motifi658 – 6625"KMSKS" region

    Sequence similaritiesi

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiCOG0525.
    HOVERGENiHBG017878.
    InParanoidiQ5ST30.
    KOiK01873.
    OMAiCEEISAE.
    OrthoDBiEOG7DZ8J5.
    PhylomeDBiQ5ST30.
    TreeFamiTF354250.

    Family and domain databases

    Gene3Di1.10.730.10. 1 hit.
    3.40.50.620. 3 hits.
    3.90.740.10. 1 hit.
    InterProiIPR001412. aa-tRNA-synth_I_CS.
    IPR002300. aa-tRNA-synth_Ia.
    IPR014729. Rossmann-like_a/b/a_fold.
    IPR009080. tRNAsynth_1a_anticodon-bd.
    IPR013155. V/L/I-tRNA-synth_anticodon-bd.
    IPR009008. Val/Leu/Ile-tRNA-synth_edit.
    IPR002303. Valyl-tRNA_ligase.
    [Graphical view]
    PfamiPF08264. Anticodon_1. 1 hit.
    PF00133. tRNA-synt_1. 1 hit.
    [Graphical view]
    PRINTSiPR00986. TRNASYNTHVAL.
    SUPFAMiSSF47323. SSF47323. 1 hit.
    SSF50677. SSF50677. 1 hit.
    TIGRFAMsiTIGR00422. valS. 1 hit.
    PROSITEiPS00178. AA_TRNA_LIGASE_I. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5ST30-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPHLPLASFR PPFWGLRHSR GLPRFHSVST QSEPHGSPIS RRNREAKQKR     50
    LREKQATLEA EIAGESKSPA ESIKAWRPKE LVLYEIPTKP GEKKDVSGPL 100
    PPAYSPRYVE AAWYPWWVRE GFFKPEYQAR LPQATGETFS MCIPPPNVTG 150
    SLHIGHALTV AIQDALVRWH RMRGDQVLWV PGSDHAGIAT QAVVEKQLWK 200
    ERGVRRHELS REAFLREVWQ WKEAKGGEIC EQLRALGASL DWDRECFTMD 250
    VGSSVAVTEA FVRLYKAGLL YRNHQLVNWS CALRSAISDI EVENRPLPGH 300
    TQLRLPGCPT PVSFGLLFSV AFPVDGEPDA EVVVGTTRPE TLPGDVAVAV 350
    HPDDSRYTHL HGRQLRHPLM GQPLPLITDY AVQPHVGTGA VKVTPAHSPA 400
    DAEMGARHGL SPLNVIAEDG TMTSLCGDWL QGLHRFVARE KIMSVLSEWG 450
    LFRGLQNHPM VLPICSRSGD VIEYLLKNQW FVRCQEMGAR AAKAVESGAL 500
    ELSPSFHQKN WQHWFSHIGD WCVSRQLWWG HQIPAYLVVE DHAQGEEDCW 550
    VVGRSEAEAR EVAAELTGRP GAELTLERDP DVLDTWFSSA LFPFSALGWP 600
    QETPDLARFY PLSLLETGSD LLLFWVGRMV MLGTQLTGQL PFSKVLLHPM 650
    VRDRQGRKMS KSLGNVLDPR DIISGVEMQV LQEKLRSGNL DPAELAIVAA 700
    AQKKDFPHGI PECGTDALRF TLCSHGVQAG DLHLSVSEVQ SCRHFCNKIW 750
    NALRFILNAL GEKFVPQPAE ELSPSSPMDA WILSRLALAA QECERGFLTR 800
    ELSLVTHALH HFWLHNLCDV YLEAVKPVLW HSPRPLGPPQ VLFSCADLGL 850
    RLLAPLMPFL AEELWQRLPP RPGCPPAPSI SVAPYPSACS LEHWRQPELE 900
    RRFSRVQEVV QVLRALRATY QLTKARPRVL LQSSEPGDQG LFEAFLEPLG 950
    TLGYCGAVGL LPPGAAAPSG WAQAPLSDTA QVYMELQGLV DPQIQLPLLA 1000
    ARRYKLQKQL DSLTARTPSE GEAGTQRQQK LSSLQLELSK LDKAASHLRQ 1050
    LMDEPPAPGS PEL 1063
    Length:1,063
    Mass (Da):118,490
    Last modified:May 18, 2010 - v2
    Checksum:i0212C6361A87DF8B
    GO
    Isoform 2 (identifier: Q5ST30-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-644: MPHLPLASFR...QLTGQLPFSK → MVFFCPVPLF...PPLLTPPCPQ

    Note: No experimental confirmation available.

    Show »
    Length:501
    Mass (Da):55,078
    Checksum:i6F274961A95460AF
    GO
    Isoform 3 (identifier: Q5ST30-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-140: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:923
    Mass (Da):102,416
    Checksum:i2949E6A77692F99D
    GO
    Isoform 4 (identifier: Q5ST30-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MGGKAWPRRAVGTAGGPCAEQISAPFQTLLM

    Note: No experimental confirmation available.

    Show »
    Length:1,093
    Mass (Da):121,543
    Checksum:i6CE3ECF0345D3D78
    GO

    Sequence cautioni

    The sequence BAD92716.1 differs from that shown. Reason: The sequence differs from that shown because it seems to be derived from a pre-mRNA.
    The sequence BAB15191.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAB67778.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence CAM24842.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAM25404.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAQ06763.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAQ09774.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAQ10925.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti25 – 251F → S in BAG65557. (PubMed:14702039)Curated
    Sequence conflicti156 – 1561H → R in BAG57195. (PubMed:14702039)Curated
    Sequence conflicti985 – 9851E → G in BAB15191. (PubMed:14702039)Curated
    Sequence conflicti1060 – 10601S → G in BAG65557. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti26 – 261H → Y.
    Corresponds to variant rs6926224 [ dbSNP | Ensembl ].
    VAR_052651
    Natural varianti64 – 641G → R.
    Corresponds to variant rs6926723 [ dbSNP | Ensembl ].
    VAR_043730
    Natural varianti449 – 4491W → R.4 Publications
    Corresponds to variant rs2249464 [ dbSNP | Ensembl ].
    VAR_043731
    Natural varianti680 – 6801V → L.4 Publications
    Corresponds to variant rs2074506 [ dbSNP | Ensembl ].
    VAR_043732
    Natural varianti765 – 7651V → M.
    Corresponds to variant rs55865499 [ dbSNP | Ensembl ].
    VAR_061910
    Natural varianti917 – 9171R → Q.3 Publications
    Corresponds to variant rs9394021 [ dbSNP | Ensembl ].
    VAR_043733
    Natural varianti965 – 9651A → T.5 Publications
    Corresponds to variant rs2252863 [ dbSNP | Ensembl ].
    VAR_043734
    Natural varianti1049 – 10491R → Q.3 Publications
    Corresponds to variant rs4678 [ dbSNP | Ensembl ].
    VAR_043735

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 644644MPHLP…LPFSK → MVFFCPVPLFCPGLAPRDPR PCSFLPPVTFGNGQRPSAVL GGPHGHVGDPAHRAAALQQV WRPEIPRHLQGNPPLLTPPC PQ in isoform 2. 1 PublicationVSP_034032Add
    BLAST
    Alternative sequencei1 – 140140Missing in isoform 3. 1 PublicationVSP_045483Add
    BLAST
    Alternative sequencei1 – 11M → MGGKAWPRRAVGTAGGPCAE QISAPFQTLLM in isoform 4. 1 PublicationVSP_046102

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB067472 mRNA. Translation: BAB67778.1. Different initiation.
    AK025618 mRNA. Translation: BAB15191.1. Different initiation.
    AK125069 mRNA. No translation available.
    AK293780 mRNA. Translation: BAG57195.1.
    AK304807 mRNA. Translation: BAG65557.1.
    AB209479 Transcribed RNA. Translation: BAD92716.1. Sequence problems.
    AL662854 Genomic DNA. Translation: CAI17437.1.
    AL662854 Genomic DNA. Translation: CAM24842.1. Sequence problems.
    AL669830 Genomic DNA. Translation: CAI18004.1.
    AL669830 Genomic DNA. Translation: CAM25404.1. Sequence problems.
    AL773541 Genomic DNA. Translation: CAI18453.1.
    BX927194 Genomic DNA. Translation: CAQ09774.1. Sequence problems.
    BX927194 Genomic DNA. Translation: CAQ09775.1.
    CR759747 Genomic DNA. Translation: CAQ06763.1. Sequence problems.
    CR759747 Genomic DNA. Translation: CAQ06764.1.
    CR936875 Genomic DNA. Translation: CAQ10925.1. Sequence problems.
    CR936875 Genomic DNA. Translation: CAQ10926.1.
    BC008844 mRNA. Translation: AAH08844.2.
    BC009355 mRNA. Translation: AAH09355.2.
    BC073838 mRNA. Translation: AAH73838.1.
    BC112054 mRNA. Translation: AAI12055.1.
    BC113605 mRNA. Translation: AAI13606.1.
    AL122037 mRNA. Translation: CAB59177.1.
    CCDSiCCDS34387.1. [Q5ST30-1]
    CCDS54980.1. [Q5ST30-4]
    CCDS54981.1. [Q5ST30-3]
    RefSeqiNP_001161205.1. NM_001167733.1. [Q5ST30-3]
    NP_001161206.1. NM_001167734.1. [Q5ST30-4]
    NP_065175.4. NM_020442.4. [Q5ST30-1]
    UniGeneiHs.597526.

    Genome annotation databases

    EnsembliENST00000321897; ENSP00000316092; ENSG00000137411. [Q5ST30-1]
    ENST00000541562; ENSP00000441000; ENSG00000137411. [Q5ST30-4]
    ENST00000542001; ENSP00000438200; ENSG00000137411. [Q5ST30-3]
    GeneIDi57176.
    KEGGihsa:57176.
    UCSCiuc003nsc.2. human. [Q5ST30-1]
    uc010jsg.2. human. [Q5ST30-2]
    uc011dmz.2. human.

    Polymorphism databases

    DMDMi296452917.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB067472 mRNA. Translation: BAB67778.1 . Different initiation.
    AK025618 mRNA. Translation: BAB15191.1 . Different initiation.
    AK125069 mRNA. No translation available.
    AK293780 mRNA. Translation: BAG57195.1 .
    AK304807 mRNA. Translation: BAG65557.1 .
    AB209479 Transcribed RNA. Translation: BAD92716.1 . Sequence problems.
    AL662854 Genomic DNA. Translation: CAI17437.1 .
    AL662854 Genomic DNA. Translation: CAM24842.1 . Sequence problems.
    AL669830 Genomic DNA. Translation: CAI18004.1 .
    AL669830 Genomic DNA. Translation: CAM25404.1 . Sequence problems.
    AL773541 Genomic DNA. Translation: CAI18453.1 .
    BX927194 Genomic DNA. Translation: CAQ09774.1 . Sequence problems.
    BX927194 Genomic DNA. Translation: CAQ09775.1 .
    CR759747 Genomic DNA. Translation: CAQ06763.1 . Sequence problems.
    CR759747 Genomic DNA. Translation: CAQ06764.1 .
    CR936875 Genomic DNA. Translation: CAQ10925.1 . Sequence problems.
    CR936875 Genomic DNA. Translation: CAQ10926.1 .
    BC008844 mRNA. Translation: AAH08844.2 .
    BC009355 mRNA. Translation: AAH09355.2 .
    BC073838 mRNA. Translation: AAH73838.1 .
    BC112054 mRNA. Translation: AAI12055.1 .
    BC113605 mRNA. Translation: AAI13606.1 .
    AL122037 mRNA. Translation: CAB59177.1 .
    CCDSi CCDS34387.1. [Q5ST30-1 ]
    CCDS54980.1. [Q5ST30-4 ]
    CCDS54981.1. [Q5ST30-3 ]
    RefSeqi NP_001161205.1. NM_001167733.1. [Q5ST30-3 ]
    NP_001161206.1. NM_001167734.1. [Q5ST30-4 ]
    NP_065175.4. NM_020442.4. [Q5ST30-1 ]
    UniGenei Hs.597526.

    3D structure databases

    ProteinModelPortali Q5ST30.
    SMRi Q5ST30. Positions 100-945.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121426. 4 interactions.
    IntActi Q5ST30. 2 interactions.
    MINTi MINT-8052670.
    STRINGi 9606.ENSP00000408337.

    PTM databases

    PhosphoSitei Q5ST30.

    Polymorphism databases

    DMDMi 296452917.

    Proteomic databases

    MaxQBi Q5ST30.
    PaxDbi Q5ST30.
    PRIDEi Q5ST30.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000321897 ; ENSP00000316092 ; ENSG00000137411 . [Q5ST30-1 ]
    ENST00000541562 ; ENSP00000441000 ; ENSG00000137411 . [Q5ST30-4 ]
    ENST00000542001 ; ENSP00000438200 ; ENSG00000137411 . [Q5ST30-3 ]
    GeneIDi 57176.
    KEGGi hsa:57176.
    UCSCi uc003nsc.2. human. [Q5ST30-1 ]
    uc010jsg.2. human. [Q5ST30-2 ]
    uc011dmz.2. human.

    Organism-specific databases

    CTDi 57176.
    GeneCardsi GC06P030876.
    H-InvDB HIX0166334.
    HIX0166693.
    HIX0200924.
    HGNCi HGNC:21642. VARS2.
    MIMi 612802. gene.
    neXtProti NX_Q5ST30.
    PharmGKBi PA164742816.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0525.
    HOVERGENi HBG017878.
    InParanoidi Q5ST30.
    KOi K01873.
    OMAi CEEISAE.
    OrthoDBi EOG7DZ8J5.
    PhylomeDBi Q5ST30.
    TreeFami TF354250.

    Enzyme and pathway databases

    Reactomei REACT_15302. Mitochondrial tRNA aminoacylation.

    Miscellaneous databases

    ChiTaRSi VARS2. human.
    GenomeRNAii 57176.
    NextBioi 63203.
    PROi Q5ST30.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q5ST30.
    Bgeei Q5ST30.
    CleanExi HS_VARS2.
    Genevestigatori Q5ST30.

    Family and domain databases

    Gene3Di 1.10.730.10. 1 hit.
    3.40.50.620. 3 hits.
    3.90.740.10. 1 hit.
    InterProi IPR001412. aa-tRNA-synth_I_CS.
    IPR002300. aa-tRNA-synth_Ia.
    IPR014729. Rossmann-like_a/b/a_fold.
    IPR009080. tRNAsynth_1a_anticodon-bd.
    IPR013155. V/L/I-tRNA-synth_anticodon-bd.
    IPR009008. Val/Leu/Ile-tRNA-synth_edit.
    IPR002303. Valyl-tRNA_ligase.
    [Graphical view ]
    Pfami PF08264. Anticodon_1. 1 hit.
    PF00133. tRNA-synt_1. 1 hit.
    [Graphical view ]
    PRINTSi PR00986. TRNASYNTHVAL.
    SUPFAMi SSF47323. SSF47323. 1 hit.
    SSF50677. SSF50677. 1 hit.
    TIGRFAMsi TIGR00422. valS. 1 hit.
    PROSITEi PS00178. AA_TRNA_LIGASE_I. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins."
      Nagase T., Kikuno R., Ohara O.
      DNA Res. 8:179-187(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLN-1049.
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 416-1063 (ISOFORM 1), VARIANTS ARG-449; LEU-680; GLN-917 AND THR-965.
      Tissue: Cerebellum, Thalamus and Uterus.
    3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ARG-449; LEU-680 AND THR-965.
      Tissue: Brain.
    4. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS ARG-449; LEU-680; GLN-917; THR-965 AND GLN-1049.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ARG-449; LEU-680; GLN-917; THR-965 AND GLN-1049.
      Tissue: Brain, Eye and Skin.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 748-1063 (ISOFORM 1), VARIANT THR-965.
      Tissue: Testis.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSYVM_HUMAN
    AccessioniPrimary (citable) accession number: Q5ST30
    Secondary accession number(s): A2ABL7
    , B4DET4, B4E3P5, F5GXJ0, F5H323, Q2M2A0, Q59FI1, Q5SQ96, Q5SS98, Q6DKJ5, Q6ZV24, Q96GN2, Q96H77, Q96Q02, Q9H6R2, Q9UFH7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 10, 2008
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 105 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Aminoacyl-tRNA synthetases
      List of aminoacyl-tRNA synthetase entries
    2. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3