Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Valine--tRNA ligase, mitochondrial

Gene

VARS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + L-valine + tRNA(Val) = AMP + diphosphate + L-valyl-tRNA(Val).

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei661ATPBy similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Aminoacyl-tRNA synthetase, Ligase

Keywords - Biological processi

Protein biosynthesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS06340-MONOMER.
ReactomeiR-HSA-379726. Mitochondrial tRNA aminoacylation.

Names & Taxonomyi

Protein namesi
Recommended name:
Valine--tRNA ligase, mitochondrial (EC:6.1.1.9)
Alternative name(s):
Valyl-tRNA synthetase
Short name:
ValRS
Valyl-tRNA synthetase-like
Gene namesi
Name:VARS2
Synonyms:KIAA1885, VARS2L, VARSL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21642. VARS2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Involvement in diseasei

Combined oxidative phosphorylation deficiency 20 (COXPD20)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder due to mitochondrial respiratory chain complex defects. Clinical features are variable and include muscle weakness with hypotonia, central neurological disease with progressive external ophthalmoplegia, ptosis and ataxia, delayed psychomotor development, cardiomyopathy, abnormal liver function, facial dysmorphism, microcephaly and epilepsy.
See also OMIM:615917
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_071850337T → I in COXPD20; decreased levels of the protein. 1 PublicationCorresponds to variant rs587777585dbSNPEnsembl.1
Natural variantiVAR_071851349A → T in COXPD20. 1 PublicationCorresponds to variant rs587777583dbSNPEnsembl.1
Natural variantiVAR_071852596A → D in COXPD20. 1 PublicationCorresponds to variant rs587777584dbSNPEnsembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi57176.
MalaCardsiVARS2.
MIMi615917. phenotype.
OpenTargetsiENSG00000137411.
ENSG00000223494.
PharmGKBiPA164742816.

Polymorphism and mutation databases

BioMutaiVARS2.
DMDMi296452917.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 26MitochondrionSequence analysisAdd BLAST26
ChainiPRO_000033800027 – 1063Valine--tRNA ligase, mitochondrialAdd BLAST1037

Proteomic databases

EPDiQ5ST30.
MaxQBiQ5ST30.
PaxDbiQ5ST30.
PeptideAtlasiQ5ST30.
PRIDEiQ5ST30.

PTM databases

iPTMnetiQ5ST30.
PhosphoSitePlusiQ5ST30.

Expressioni

Gene expression databases

BgeeiENSG00000137411.
CleanExiHS_VARS2.
ExpressionAtlasiQ5ST30. baseline and differential.
GenevisibleiQ5ST30. HS.

Organism-specific databases

HPAiHPA062449.
HPA070267.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ABI2Q9NYB93EBI-10244997,EBI-743598
CMTM5Q96DZ93EBI-10244969,EBI-2548702
MAL2Q969L23EBI-10244969,EBI-944295
NCK2O436393EBI-10244997,EBI-713635
SORBS3O605043EBI-10244997,EBI-741237

Protein-protein interaction databases

BioGridi121426. 10 interactors.
IntActiQ5ST30. 7 interactors.
MINTiMINT-8052670.
STRINGi9606.ENSP00000441000.

Structurei

3D structure databases

ProteinModelPortaliQ5ST30.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi146 – 156"HIGH" regionAdd BLAST11
Motifi658 – 662"KMSKS" region5

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG0432. Eukaryota.
COG0525. LUCA.
GeneTreeiENSGT00550000074727.
HOVERGENiHBG017878.
InParanoidiQ5ST30.
KOiK01873.
OMAiPMVLPLC.
OrthoDBiEOG091G01XH.
PhylomeDBiQ5ST30.
TreeFamiTF354250.

Family and domain databases

CDDicd07962. Anticodon_Ia_Val. 1 hit.
Gene3Di1.10.730.10. 1 hit.
3.40.50.620. 3 hits.
3.90.740.10. 1 hit.
InterProiIPR001412. aa-tRNA-synth_I_CS.
IPR002300. aa-tRNA-synth_Ia.
IPR033705. Anticodon_Ia_Val.
IPR013155. M/V/L/I-tRNA-synth_anticd-bd.
IPR014729. Rossmann-like_a/b/a_fold.
IPR009080. tRNAsynth_Ia_anticodon-bd.
IPR009008. Val/Leu/Ile-tRNA-synth_edit.
IPR002303. Valyl-tRNA_ligase.
[Graphical view]
PfamiPF08264. Anticodon_1. 1 hit.
PF00133. tRNA-synt_1. 1 hit.
[Graphical view]
PRINTSiPR00986. TRNASYNTHVAL.
SUPFAMiSSF47323. SSF47323. 1 hit.
SSF50677. SSF50677. 1 hit.
TIGRFAMsiTIGR00422. valS. 1 hit.
PROSITEiPS00178. AA_TRNA_LIGASE_I. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5ST30-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPHLPLASFR PPFWGLRHSR GLPRFHSVST QSEPHGSPIS RRNREAKQKR
60 70 80 90 100
LREKQATLEA EIAGESKSPA ESIKAWRPKE LVLYEIPTKP GEKKDVSGPL
110 120 130 140 150
PPAYSPRYVE AAWYPWWVRE GFFKPEYQAR LPQATGETFS MCIPPPNVTG
160 170 180 190 200
SLHIGHALTV AIQDALVRWH RMRGDQVLWV PGSDHAGIAT QAVVEKQLWK
210 220 230 240 250
ERGVRRHELS REAFLREVWQ WKEAKGGEIC EQLRALGASL DWDRECFTMD
260 270 280 290 300
VGSSVAVTEA FVRLYKAGLL YRNHQLVNWS CALRSAISDI EVENRPLPGH
310 320 330 340 350
TQLRLPGCPT PVSFGLLFSV AFPVDGEPDA EVVVGTTRPE TLPGDVAVAV
360 370 380 390 400
HPDDSRYTHL HGRQLRHPLM GQPLPLITDY AVQPHVGTGA VKVTPAHSPA
410 420 430 440 450
DAEMGARHGL SPLNVIAEDG TMTSLCGDWL QGLHRFVARE KIMSVLSEWG
460 470 480 490 500
LFRGLQNHPM VLPICSRSGD VIEYLLKNQW FVRCQEMGAR AAKAVESGAL
510 520 530 540 550
ELSPSFHQKN WQHWFSHIGD WCVSRQLWWG HQIPAYLVVE DHAQGEEDCW
560 570 580 590 600
VVGRSEAEAR EVAAELTGRP GAELTLERDP DVLDTWFSSA LFPFSALGWP
610 620 630 640 650
QETPDLARFY PLSLLETGSD LLLFWVGRMV MLGTQLTGQL PFSKVLLHPM
660 670 680 690 700
VRDRQGRKMS KSLGNVLDPR DIISGVEMQV LQEKLRSGNL DPAELAIVAA
710 720 730 740 750
AQKKDFPHGI PECGTDALRF TLCSHGVQAG DLHLSVSEVQ SCRHFCNKIW
760 770 780 790 800
NALRFILNAL GEKFVPQPAE ELSPSSPMDA WILSRLALAA QECERGFLTR
810 820 830 840 850
ELSLVTHALH HFWLHNLCDV YLEAVKPVLW HSPRPLGPPQ VLFSCADLGL
860 870 880 890 900
RLLAPLMPFL AEELWQRLPP RPGCPPAPSI SVAPYPSACS LEHWRQPELE
910 920 930 940 950
RRFSRVQEVV QVLRALRATY QLTKARPRVL LQSSEPGDQG LFEAFLEPLG
960 970 980 990 1000
TLGYCGAVGL LPPGAAAPSG WAQAPLSDTA QVYMELQGLV DPQIQLPLLA
1010 1020 1030 1040 1050
ARRYKLQKQL DSLTARTPSE GEAGTQRQQK LSSLQLELSK LDKAASHLRQ
1060
LMDEPPAPGS PEL
Length:1,063
Mass (Da):118,490
Last modified:May 18, 2010 - v2
Checksum:i0212C6361A87DF8B
GO
Isoform 2 (identifier: Q5ST30-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-644: MPHLPLASFR...QLTGQLPFSK → MVFFCPVPLF...PPLLTPPCPQ

Note: No experimental confirmation available.
Show »
Length:501
Mass (Da):55,078
Checksum:i6F274961A95460AF
GO
Isoform 3 (identifier: Q5ST30-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-140: Missing.

Note: No experimental confirmation available.
Show »
Length:923
Mass (Da):102,416
Checksum:i2949E6A77692F99D
GO
Isoform 4 (identifier: Q5ST30-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGKAWPRRAVGTAGGPCAEQISAPFQTLLM

Note: No experimental confirmation available.
Show »
Length:1,093
Mass (Da):121,543
Checksum:i6CE3ECF0345D3D78
GO

Sequence cautioni

The sequence BAB15191 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB67778 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAD92716 differs from that shown. The sequence differs from that shown because it seems to be derived from a pre-mRNA.Curated
The sequence CAM24842 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAM25404 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAQ06763 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAQ09774 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAQ10925 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti25F → S in BAG65557 (PubMed:14702039).Curated1
Sequence conflicti156H → R in BAG57195 (PubMed:14702039).Curated1
Sequence conflicti985E → G in BAB15191 (PubMed:14702039).Curated1
Sequence conflicti1060S → G in BAG65557 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05265126H → Y.Corresponds to variant rs6926224dbSNPEnsembl.1
Natural variantiVAR_04373064G → R.Corresponds to variant rs6926723dbSNPEnsembl.1
Natural variantiVAR_071850337T → I in COXPD20; decreased levels of the protein. 1 PublicationCorresponds to variant rs587777585dbSNPEnsembl.1
Natural variantiVAR_071851349A → T in COXPD20. 1 PublicationCorresponds to variant rs587777583dbSNPEnsembl.1
Natural variantiVAR_043731449W → R.4 PublicationsCorresponds to variant rs2249464dbSNPEnsembl.1
Natural variantiVAR_071852596A → D in COXPD20. 1 PublicationCorresponds to variant rs587777584dbSNPEnsembl.1
Natural variantiVAR_043732680V → L.4 PublicationsCorresponds to variant rs2074506dbSNPEnsembl.1
Natural variantiVAR_061910765V → M.Corresponds to variant rs55865499dbSNPEnsembl.1
Natural variantiVAR_043733917R → Q.3 PublicationsCorresponds to variant rs9394021dbSNPEnsembl.1
Natural variantiVAR_043734965A → T.5 PublicationsCorresponds to variant rs2252863dbSNPEnsembl.1
Natural variantiVAR_0437351049R → Q.3 PublicationsCorresponds to variant rs4678dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0340321 – 644MPHLP…LPFSK → MVFFCPVPLFCPGLAPRDPR PCSFLPPVTFGNGQRPSAVL GGPHGHVGDPAHRAAALQQV WRPEIPRHLQGNPPLLTPPC PQ in isoform 2. 1 PublicationAdd BLAST644
Alternative sequenceiVSP_0454831 – 140Missing in isoform 3. 1 PublicationAdd BLAST140
Alternative sequenceiVSP_0461021M → MGGKAWPRRAVGTAGGPCAE QISAPFQTLLM in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB067472 mRNA. Translation: BAB67778.1. Different initiation.
AK025618 mRNA. Translation: BAB15191.1. Different initiation.
AK125069 mRNA. No translation available.
AK293780 mRNA. Translation: BAG57195.1.
AK304807 mRNA. Translation: BAG65557.1.
AB209479 Transcribed RNA. Translation: BAD92716.1. Sequence problems.
AL662854 Genomic DNA. Translation: CAI17437.1.
AL662854 Genomic DNA. Translation: CAM24842.1. Sequence problems.
AL669830 Genomic DNA. Translation: CAI18004.1.
AL669830 Genomic DNA. Translation: CAM25404.1. Sequence problems.
AL773541 Genomic DNA. Translation: CAI18453.1.
BX927194 Genomic DNA. Translation: CAQ09774.1. Sequence problems.
BX927194 Genomic DNA. Translation: CAQ09775.1.
CR759747 Genomic DNA. Translation: CAQ06763.1. Sequence problems.
CR759747 Genomic DNA. Translation: CAQ06764.1.
CR936875 Genomic DNA. Translation: CAQ10925.1. Sequence problems.
CR936875 Genomic DNA. Translation: CAQ10926.1.
BC008844 mRNA. Translation: AAH08844.2.
BC009355 mRNA. Translation: AAH09355.2.
BC073838 mRNA. Translation: AAH73838.1.
BC112054 mRNA. Translation: AAI12055.1.
BC113605 mRNA. Translation: AAI13606.1.
AL122037 mRNA. Translation: CAB59177.1.
CCDSiCCDS34387.1. [Q5ST30-1]
CCDS54980.1. [Q5ST30-4]
CCDS54981.1. [Q5ST30-3]
RefSeqiNP_001161205.1. NM_001167733.2. [Q5ST30-3]
NP_001161206.1. NM_001167734.1. [Q5ST30-4]
NP_065175.4. NM_020442.5. [Q5ST30-1]
UniGeneiHs.597526.

Genome annotation databases

EnsembliENST00000321897; ENSP00000316092; ENSG00000137411. [Q5ST30-1]
ENST00000415079; ENSP00000400867; ENSG00000223494. [Q5ST30-1]
ENST00000541562; ENSP00000441000; ENSG00000137411. [Q5ST30-4]
ENST00000546854; ENSP00000446839; ENSG00000223494. [Q5ST30-4]
ENST00000625423; ENSP00000485818; ENSG00000137411. [Q5ST30-3]
GeneIDi57176.
KEGGihsa:57176.
UCSCiuc003nsc.3. human. [Q5ST30-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB067472 mRNA. Translation: BAB67778.1. Different initiation.
AK025618 mRNA. Translation: BAB15191.1. Different initiation.
AK125069 mRNA. No translation available.
AK293780 mRNA. Translation: BAG57195.1.
AK304807 mRNA. Translation: BAG65557.1.
AB209479 Transcribed RNA. Translation: BAD92716.1. Sequence problems.
AL662854 Genomic DNA. Translation: CAI17437.1.
AL662854 Genomic DNA. Translation: CAM24842.1. Sequence problems.
AL669830 Genomic DNA. Translation: CAI18004.1.
AL669830 Genomic DNA. Translation: CAM25404.1. Sequence problems.
AL773541 Genomic DNA. Translation: CAI18453.1.
BX927194 Genomic DNA. Translation: CAQ09774.1. Sequence problems.
BX927194 Genomic DNA. Translation: CAQ09775.1.
CR759747 Genomic DNA. Translation: CAQ06763.1. Sequence problems.
CR759747 Genomic DNA. Translation: CAQ06764.1.
CR936875 Genomic DNA. Translation: CAQ10925.1. Sequence problems.
CR936875 Genomic DNA. Translation: CAQ10926.1.
BC008844 mRNA. Translation: AAH08844.2.
BC009355 mRNA. Translation: AAH09355.2.
BC073838 mRNA. Translation: AAH73838.1.
BC112054 mRNA. Translation: AAI12055.1.
BC113605 mRNA. Translation: AAI13606.1.
AL122037 mRNA. Translation: CAB59177.1.
CCDSiCCDS34387.1. [Q5ST30-1]
CCDS54980.1. [Q5ST30-4]
CCDS54981.1. [Q5ST30-3]
RefSeqiNP_001161205.1. NM_001167733.2. [Q5ST30-3]
NP_001161206.1. NM_001167734.1. [Q5ST30-4]
NP_065175.4. NM_020442.5. [Q5ST30-1]
UniGeneiHs.597526.

3D structure databases

ProteinModelPortaliQ5ST30.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121426. 10 interactors.
IntActiQ5ST30. 7 interactors.
MINTiMINT-8052670.
STRINGi9606.ENSP00000441000.

PTM databases

iPTMnetiQ5ST30.
PhosphoSitePlusiQ5ST30.

Polymorphism and mutation databases

BioMutaiVARS2.
DMDMi296452917.

Proteomic databases

EPDiQ5ST30.
MaxQBiQ5ST30.
PaxDbiQ5ST30.
PeptideAtlasiQ5ST30.
PRIDEiQ5ST30.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000321897; ENSP00000316092; ENSG00000137411. [Q5ST30-1]
ENST00000415079; ENSP00000400867; ENSG00000223494. [Q5ST30-1]
ENST00000541562; ENSP00000441000; ENSG00000137411. [Q5ST30-4]
ENST00000546854; ENSP00000446839; ENSG00000223494. [Q5ST30-4]
ENST00000625423; ENSP00000485818; ENSG00000137411. [Q5ST30-3]
GeneIDi57176.
KEGGihsa:57176.
UCSCiuc003nsc.3. human. [Q5ST30-1]

Organism-specific databases

CTDi57176.
DisGeNETi57176.
GeneCardsiVARS2.
H-InvDBHIX0166334.
HIX0166693.
HIX0200924.
HGNCiHGNC:21642. VARS2.
HPAiHPA062449.
HPA070267.
MalaCardsiVARS2.
MIMi612802. gene.
615917. phenotype.
neXtProtiNX_Q5ST30.
OpenTargetsiENSG00000137411.
ENSG00000223494.
PharmGKBiPA164742816.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0432. Eukaryota.
COG0525. LUCA.
GeneTreeiENSGT00550000074727.
HOVERGENiHBG017878.
InParanoidiQ5ST30.
KOiK01873.
OMAiPMVLPLC.
OrthoDBiEOG091G01XH.
PhylomeDBiQ5ST30.
TreeFamiTF354250.

Enzyme and pathway databases

BioCyciZFISH:HS06340-MONOMER.
ReactomeiR-HSA-379726. Mitochondrial tRNA aminoacylation.

Miscellaneous databases

ChiTaRSiVARS2. human.
GenomeRNAii57176.
PROiQ5ST30.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000137411.
CleanExiHS_VARS2.
ExpressionAtlasiQ5ST30. baseline and differential.
GenevisibleiQ5ST30. HS.

Family and domain databases

CDDicd07962. Anticodon_Ia_Val. 1 hit.
Gene3Di1.10.730.10. 1 hit.
3.40.50.620. 3 hits.
3.90.740.10. 1 hit.
InterProiIPR001412. aa-tRNA-synth_I_CS.
IPR002300. aa-tRNA-synth_Ia.
IPR033705. Anticodon_Ia_Val.
IPR013155. M/V/L/I-tRNA-synth_anticd-bd.
IPR014729. Rossmann-like_a/b/a_fold.
IPR009080. tRNAsynth_Ia_anticodon-bd.
IPR009008. Val/Leu/Ile-tRNA-synth_edit.
IPR002303. Valyl-tRNA_ligase.
[Graphical view]
PfamiPF08264. Anticodon_1. 1 hit.
PF00133. tRNA-synt_1. 1 hit.
[Graphical view]
PRINTSiPR00986. TRNASYNTHVAL.
SUPFAMiSSF47323. SSF47323. 1 hit.
SSF50677. SSF50677. 1 hit.
TIGRFAMsiTIGR00422. valS. 1 hit.
PROSITEiPS00178. AA_TRNA_LIGASE_I. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSYVM_HUMAN
AccessioniPrimary (citable) accession number: Q5ST30
Secondary accession number(s): A2ABL7
, B4DET4, B4E3P5, F5GXJ0, F5H323, Q2M2A0, Q59FI1, Q5SQ96, Q5SS98, Q6DKJ5, Q6ZV24, Q96GN2, Q96H77, Q96Q02, Q9H6R2, Q9UFH7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: May 18, 2010
Last modified: November 2, 2016
This is version 125 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Aminoacyl-tRNA synthetases
    List of aminoacyl-tRNA synthetase entries
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.