Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5ST30 (SYVM_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 100. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Valine--tRNA ligase, mitochondrial

EC=6.1.1.9
Alternative name(s):
Valyl-tRNA synthetase
Short name=ValRS
Valyl-tRNA synthetase-like
Gene names
Name:VARS2
Synonyms:KIAA1885, VARS2L, VARSL
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1063 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Catalytic activity

ATP + L-valine + tRNA(Val) = AMP + diphosphate + L-valyl-tRNA(Val).

Subcellular location

Mitochondrion Potential.

Sequence similarities

Belongs to the class-I aminoacyl-tRNA synthetase family.

Sequence caution

The sequence BAB15191.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAB67778.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence BAD92716.1 differs from that shown. Reason: The sequence differs from that shown because it seems to be derived from a pre-mRNA.

The sequence CAM24842.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAM25404.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAQ06763.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAQ09774.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAQ10925.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5ST30-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5ST30-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-644: MPHLPLASFR...QLTGQLPFSK → MVFFCPVPLF...PPLLTPPCPQ
Note: No experimental confirmation available.
Isoform 3 (identifier: Q5ST30-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-140: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q5ST30-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGKAWPRRAVGTAGGPCAEQISAPFQTLLM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – 2626Mitochondrion Potential
Chain27 – 10631037Valine--tRNA ligase, mitochondrial
PRO_0000338000

Regions

Motif146 – 15611"HIGH" region
Motif658 – 6625"KMSKS" region

Sites

Binding site6611ATP By similarity

Natural variations

Alternative sequence1 – 644644MPHLP…LPFSK → MVFFCPVPLFCPGLAPRDPR PCSFLPPVTFGNGQRPSAVL GGPHGHVGDPAHRAAALQQV WRPEIPRHLQGNPPLLTPPC PQ in isoform 2.
VSP_034032
Alternative sequence1 – 140140Missing in isoform 3.
VSP_045483
Alternative sequence11M → MGGKAWPRRAVGTAGGPCAE QISAPFQTLLM in isoform 4.
VSP_046102
Natural variant261H → Y.
Corresponds to variant rs6926224 [ dbSNP | Ensembl ].
VAR_052651
Natural variant641G → R.
Corresponds to variant rs6926723 [ dbSNP | Ensembl ].
VAR_043730
Natural variant4491W → R. Ref.2 Ref.3 Ref.4 Ref.5
Corresponds to variant rs2249464 [ dbSNP | Ensembl ].
VAR_043731
Natural variant6801V → L. Ref.2 Ref.3 Ref.4 Ref.5
Corresponds to variant rs2074506 [ dbSNP | Ensembl ].
VAR_043732
Natural variant7651V → M.
Corresponds to variant rs55865499 [ dbSNP | Ensembl ].
VAR_061910
Natural variant9171R → Q. Ref.2 Ref.4 Ref.5
Corresponds to variant rs9394021 [ dbSNP | Ensembl ].
VAR_043733
Natural variant9651A → T. Ref.2 Ref.3 Ref.4 Ref.5 Ref.6
Corresponds to variant rs2252863 [ dbSNP | Ensembl ].
VAR_043734
Natural variant10491R → Q. Ref.1 Ref.4 Ref.5
Corresponds to variant rs4678 [ dbSNP | Ensembl ].
VAR_043735

Experimental info

Sequence conflict251F → S in BAG65557. Ref.2
Sequence conflict1561H → R in BAG57195. Ref.2
Sequence conflict9851E → G in BAB15191. Ref.2
Sequence conflict10601S → G in BAG65557. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 18, 2010. Version 2.
Checksum: 0212C6361A87DF8B

FASTA1,063118,490
        10         20         30         40         50         60 
MPHLPLASFR PPFWGLRHSR GLPRFHSVST QSEPHGSPIS RRNREAKQKR LREKQATLEA 

        70         80         90        100        110        120 
EIAGESKSPA ESIKAWRPKE LVLYEIPTKP GEKKDVSGPL PPAYSPRYVE AAWYPWWVRE 

       130        140        150        160        170        180 
GFFKPEYQAR LPQATGETFS MCIPPPNVTG SLHIGHALTV AIQDALVRWH RMRGDQVLWV 

       190        200        210        220        230        240 
PGSDHAGIAT QAVVEKQLWK ERGVRRHELS REAFLREVWQ WKEAKGGEIC EQLRALGASL 

       250        260        270        280        290        300 
DWDRECFTMD VGSSVAVTEA FVRLYKAGLL YRNHQLVNWS CALRSAISDI EVENRPLPGH 

       310        320        330        340        350        360 
TQLRLPGCPT PVSFGLLFSV AFPVDGEPDA EVVVGTTRPE TLPGDVAVAV HPDDSRYTHL 

       370        380        390        400        410        420 
HGRQLRHPLM GQPLPLITDY AVQPHVGTGA VKVTPAHSPA DAEMGARHGL SPLNVIAEDG 

       430        440        450        460        470        480 
TMTSLCGDWL QGLHRFVARE KIMSVLSEWG LFRGLQNHPM VLPICSRSGD VIEYLLKNQW 

       490        500        510        520        530        540 
FVRCQEMGAR AAKAVESGAL ELSPSFHQKN WQHWFSHIGD WCVSRQLWWG HQIPAYLVVE 

       550        560        570        580        590        600 
DHAQGEEDCW VVGRSEAEAR EVAAELTGRP GAELTLERDP DVLDTWFSSA LFPFSALGWP 

       610        620        630        640        650        660 
QETPDLARFY PLSLLETGSD LLLFWVGRMV MLGTQLTGQL PFSKVLLHPM VRDRQGRKMS 

       670        680        690        700        710        720 
KSLGNVLDPR DIISGVEMQV LQEKLRSGNL DPAELAIVAA AQKKDFPHGI PECGTDALRF 

       730        740        750        760        770        780 
TLCSHGVQAG DLHLSVSEVQ SCRHFCNKIW NALRFILNAL GEKFVPQPAE ELSPSSPMDA 

       790        800        810        820        830        840 
WILSRLALAA QECERGFLTR ELSLVTHALH HFWLHNLCDV YLEAVKPVLW HSPRPLGPPQ 

       850        860        870        880        890        900 
VLFSCADLGL RLLAPLMPFL AEELWQRLPP RPGCPPAPSI SVAPYPSACS LEHWRQPELE 

       910        920        930        940        950        960 
RRFSRVQEVV QVLRALRATY QLTKARPRVL LQSSEPGDQG LFEAFLEPLG TLGYCGAVGL 

       970        980        990       1000       1010       1020 
LPPGAAAPSG WAQAPLSDTA QVYMELQGLV DPQIQLPLLA ARRYKLQKQL DSLTARTPSE 

      1030       1040       1050       1060 
GEAGTQRQQK LSSLQLELSK LDKAASHLRQ LMDEPPAPGS PEL 

« Hide

Isoform 2 [UniParc].

Checksum: 6F274961A95460AF
Show »

FASTA50155,078
Isoform 3 [UniParc].

Checksum: 2949E6A77692F99D
Show »

FASTA923102,416
Isoform 4 [UniParc].

Checksum: 6CE3ECF0345D3D78
Show »

FASTA1,093121,543

References

[1]"Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins."
Nagase T., Kikuno R., Ohara O.
DNA Res. 8:179-187(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLN-1049.
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 416-1063 (ISOFORM 1), VARIANTS ARG-449; LEU-680; GLN-917 AND THR-965.
Tissue: Cerebellum, Thalamus and Uterus.
[3]Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ARG-449; LEU-680 AND THR-965.
Tissue: Brain.
[4]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS ARG-449; LEU-680; GLN-917; THR-965 AND GLN-1049.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ARG-449; LEU-680; GLN-917; THR-965 AND GLN-1049.
Tissue: Brain, Eye and Skin.
[6]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 748-1063 (ISOFORM 1), VARIANT THR-965.
Tissue: Testis.
[7]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB067472 mRNA. Translation: BAB67778.1. Different initiation.
AK025618 mRNA. Translation: BAB15191.1. Different initiation.
AK125069 mRNA. No translation available.
AK293780 mRNA. Translation: BAG57195.1.
AK304807 mRNA. Translation: BAG65557.1.
AB209479 Transcribed RNA. Translation: BAD92716.1. Sequence problems.
AL662854 Genomic DNA. Translation: CAI17437.1.
AL662854 Genomic DNA. Translation: CAM24842.1. Sequence problems.
AL669830 Genomic DNA. Translation: CAI18004.1.
AL669830 Genomic DNA. Translation: CAM25404.1. Sequence problems.
AL773541 Genomic DNA. Translation: CAI18453.1.
BX927194 Genomic DNA. Translation: CAQ09774.1. Sequence problems.
BX927194 Genomic DNA. Translation: CAQ09775.1.
CR759747 Genomic DNA. Translation: CAQ06763.1. Sequence problems.
CR759747 Genomic DNA. Translation: CAQ06764.1.
CR936875 Genomic DNA. Translation: CAQ10925.1. Sequence problems.
CR936875 Genomic DNA. Translation: CAQ10926.1.
BC008844 mRNA. Translation: AAH08844.2.
BC009355 mRNA. Translation: AAH09355.2.
BC073838 mRNA. Translation: AAH73838.1.
BC112054 mRNA. Translation: AAI12055.1.
BC113605 mRNA. Translation: AAI13606.1.
AL122037 mRNA. Translation: CAB59177.1.
RefSeqNP_001161205.1. NM_001167733.1.
NP_001161206.1. NM_001167734.1.
NP_065175.4. NM_020442.4.
UniGeneHs.597526.

3D structure databases

ProteinModelPortalQ5ST30.
SMRQ5ST30. Positions 100-945.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121426. 4 interactions.
IntActQ5ST30. 2 interactions.
MINTMINT-8052670.
STRING9606.ENSP00000408337.

PTM databases

PhosphoSiteQ5ST30.

Polymorphism databases

DMDM296452917.

Proteomic databases

PaxDbQ5ST30.
PRIDEQ5ST30.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000321897; ENSP00000316092; ENSG00000137411. [Q5ST30-1]
ENST00000416670; ENSP00000394802; ENSG00000137411. [Q5ST30-1]
ENST00000541562; ENSP00000441000; ENSG00000137411. [Q5ST30-4]
ENST00000542001; ENSP00000438200; ENSG00000137411. [Q5ST30-3]
GeneID57176.
KEGGhsa:57176.
UCSCuc003nsc.2. human. [Q5ST30-1]
uc010jsg.2. human. [Q5ST30-2]
uc011dmz.2. human.

Organism-specific databases

CTD57176.
GeneCardsGC06P030876.
H-InvDBHIX0166334.
HIX0166693.
HIX0200924.
HGNCHGNC:21642. VARS2.
MIM612802. gene.
neXtProtNX_Q5ST30.
PharmGKBPA164742816.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0525.
HOVERGENHBG017878.
InParanoidQ5ST30.
KOK01873.
OMAHELESIS.
OrthoDBEOG7DZ8J5.
PhylomeDBQ5ST30.
TreeFamTF354250.

Enzyme and pathway databases

ReactomeREACT_71. Gene Expression.

Gene expression databases

ArrayExpressQ5ST30.
BgeeQ5ST30.
CleanExHS_VARS2.
GenevestigatorQ5ST30.

Family and domain databases

Gene3D1.10.730.10. 1 hit.
3.40.50.620. 3 hits.
3.90.740.10. 1 hit.
InterProIPR001412. aa-tRNA-synth_I_CS.
IPR002300. aa-tRNA-synth_Ia.
IPR014729. Rossmann-like_a/b/a_fold.
IPR009080. tRNAsynth_1a_anticodon-bd.
IPR013155. V/L/I-tRNA-synth_anticodon-bd.
IPR009008. Val/Leu/Ile-tRNA-synth_edit.
IPR002303. Valyl-tRNA_ligase.
[Graphical view]
PANTHERPTHR11946:SF5. PTHR11946:SF5. 1 hit.
PfamPF08264. Anticodon_1. 1 hit.
PF00133. tRNA-synt_1. 1 hit.
[Graphical view]
PRINTSPR00986. TRNASYNTHVAL.
SUPFAMSSF47323. SSF47323. 1 hit.
SSF50677. SSF50677. 1 hit.
TIGRFAMsTIGR00422. valS. 1 hit.
PROSITEPS00178. AA_TRNA_LIGASE_I. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSVARS2. human.
GenomeRNAi57176.
NextBio63203.
PROQ5ST30.
SOURCESearch...

Entry information

Entry nameSYVM_HUMAN
AccessionPrimary (citable) accession number: Q5ST30
Secondary accession number(s): A2ABL7 expand/collapse secondary AC list , B4DET4, B4E3P5, F5GXJ0, F5H323, Q2M2A0, Q59FI1, Q5SQ96, Q5SS98, Q6DKJ5, Q6ZV24, Q96GN2, Q96H77, Q96Q02, Q9H6R2, Q9UFH7
Entry history
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: May 18, 2010
Last modified: April 16, 2014
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM

Aminoacyl-tRNA synthetases

List of aminoacyl-tRNA synthetase entries