Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5ST30

- SYVM_HUMAN

UniProt

Q5ST30 - SYVM_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Valine--tRNA ligase, mitochondrial

Gene

VARS2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + L-valine + tRNA(Val) = AMP + diphosphate + L-valyl-tRNA(Val).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei661 – 6611ATPBy similarity

GO - Molecular functioni

  1. aminoacyl-tRNA editing activity Source: InterPro
  2. ATP binding Source: UniProtKB-KW
  3. valine-tRNA ligase activity Source: UniProtKB-EC

GO - Biological processi

  1. gene expression Source: Reactome
  2. tRNA aminoacylation for protein translation Source: Reactome
  3. valyl-tRNA aminoacylation Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Aminoacyl-tRNA synthetase, Ligase

Keywords - Biological processi

Protein biosynthesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_15302. Mitochondrial tRNA aminoacylation.

Names & Taxonomyi

Protein namesi
Recommended name:
Valine--tRNA ligase, mitochondrial (EC:6.1.1.9)
Alternative name(s):
Valyl-tRNA synthetase
Short name:
ValRS
Valyl-tRNA synthetase-like
Gene namesi
Name:VARS2
Synonyms:KIAA1885, VARS2L, VARSL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:21642. VARS2.

Subcellular locationi

GO - Cellular componenti

  1. mitochondrion Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164742816.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 2626MitochondrionSequence AnalysisAdd
BLAST
Chaini27 – 10631037Valine--tRNA ligase, mitochondrialPRO_0000338000Add
BLAST

Proteomic databases

MaxQBiQ5ST30.
PaxDbiQ5ST30.
PRIDEiQ5ST30.

PTM databases

PhosphoSiteiQ5ST30.

Expressioni

Gene expression databases

BgeeiQ5ST30.
CleanExiHS_VARS2.
ExpressionAtlasiQ5ST30. baseline and differential.
GenevestigatoriQ5ST30.

Interactioni

Protein-protein interaction databases

BioGridi121426. 4 interactions.
IntActiQ5ST30. 2 interactions.
MINTiMINT-8052670.
STRINGi9606.ENSP00000408337.

Structurei

3D structure databases

ProteinModelPortaliQ5ST30.
SMRiQ5ST30. Positions 100-945.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi146 – 15611"HIGH" regionAdd
BLAST
Motifi658 – 6625"KMSKS" region

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiCOG0525.
GeneTreeiENSGT00550000074727.
HOVERGENiHBG017878.
InParanoidiQ5ST30.
KOiK01873.
OMAiCEEISAE.
OrthoDBiEOG7DZ8J5.
PhylomeDBiQ5ST30.
TreeFamiTF354250.

Family and domain databases

Gene3Di1.10.730.10. 1 hit.
3.40.50.620. 3 hits.
3.90.740.10. 1 hit.
InterProiIPR001412. aa-tRNA-synth_I_CS.
IPR002300. aa-tRNA-synth_Ia.
IPR014729. Rossmann-like_a/b/a_fold.
IPR009080. tRNAsynth_1a_anticodon-bd.
IPR013155. V/L/I-tRNA-synth_anticodon-bd.
IPR009008. Val/Leu/Ile-tRNA-synth_edit.
IPR002303. Valyl-tRNA_ligase.
[Graphical view]
PfamiPF08264. Anticodon_1. 1 hit.
PF00133. tRNA-synt_1. 1 hit.
[Graphical view]
PRINTSiPR00986. TRNASYNTHVAL.
SUPFAMiSSF47323. SSF47323. 1 hit.
SSF50677. SSF50677. 1 hit.
TIGRFAMsiTIGR00422. valS. 1 hit.
PROSITEiPS00178. AA_TRNA_LIGASE_I. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5ST30-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPHLPLASFR PPFWGLRHSR GLPRFHSVST QSEPHGSPIS RRNREAKQKR
60 70 80 90 100
LREKQATLEA EIAGESKSPA ESIKAWRPKE LVLYEIPTKP GEKKDVSGPL
110 120 130 140 150
PPAYSPRYVE AAWYPWWVRE GFFKPEYQAR LPQATGETFS MCIPPPNVTG
160 170 180 190 200
SLHIGHALTV AIQDALVRWH RMRGDQVLWV PGSDHAGIAT QAVVEKQLWK
210 220 230 240 250
ERGVRRHELS REAFLREVWQ WKEAKGGEIC EQLRALGASL DWDRECFTMD
260 270 280 290 300
VGSSVAVTEA FVRLYKAGLL YRNHQLVNWS CALRSAISDI EVENRPLPGH
310 320 330 340 350
TQLRLPGCPT PVSFGLLFSV AFPVDGEPDA EVVVGTTRPE TLPGDVAVAV
360 370 380 390 400
HPDDSRYTHL HGRQLRHPLM GQPLPLITDY AVQPHVGTGA VKVTPAHSPA
410 420 430 440 450
DAEMGARHGL SPLNVIAEDG TMTSLCGDWL QGLHRFVARE KIMSVLSEWG
460 470 480 490 500
LFRGLQNHPM VLPICSRSGD VIEYLLKNQW FVRCQEMGAR AAKAVESGAL
510 520 530 540 550
ELSPSFHQKN WQHWFSHIGD WCVSRQLWWG HQIPAYLVVE DHAQGEEDCW
560 570 580 590 600
VVGRSEAEAR EVAAELTGRP GAELTLERDP DVLDTWFSSA LFPFSALGWP
610 620 630 640 650
QETPDLARFY PLSLLETGSD LLLFWVGRMV MLGTQLTGQL PFSKVLLHPM
660 670 680 690 700
VRDRQGRKMS KSLGNVLDPR DIISGVEMQV LQEKLRSGNL DPAELAIVAA
710 720 730 740 750
AQKKDFPHGI PECGTDALRF TLCSHGVQAG DLHLSVSEVQ SCRHFCNKIW
760 770 780 790 800
NALRFILNAL GEKFVPQPAE ELSPSSPMDA WILSRLALAA QECERGFLTR
810 820 830 840 850
ELSLVTHALH HFWLHNLCDV YLEAVKPVLW HSPRPLGPPQ VLFSCADLGL
860 870 880 890 900
RLLAPLMPFL AEELWQRLPP RPGCPPAPSI SVAPYPSACS LEHWRQPELE
910 920 930 940 950
RRFSRVQEVV QVLRALRATY QLTKARPRVL LQSSEPGDQG LFEAFLEPLG
960 970 980 990 1000
TLGYCGAVGL LPPGAAAPSG WAQAPLSDTA QVYMELQGLV DPQIQLPLLA
1010 1020 1030 1040 1050
ARRYKLQKQL DSLTARTPSE GEAGTQRQQK LSSLQLELSK LDKAASHLRQ
1060
LMDEPPAPGS PEL
Length:1,063
Mass (Da):118,490
Last modified:May 18, 2010 - v2
Checksum:i0212C6361A87DF8B
GO
Isoform 2 (identifier: Q5ST30-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-644: MPHLPLASFR...QLTGQLPFSK → MVFFCPVPLF...PPLLTPPCPQ

Note: No experimental confirmation available.

Show »
Length:501
Mass (Da):55,078
Checksum:i6F274961A95460AF
GO
Isoform 3 (identifier: Q5ST30-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-140: Missing.

Note: No experimental confirmation available.

Show »
Length:923
Mass (Da):102,416
Checksum:i2949E6A77692F99D
GO
Isoform 4 (identifier: Q5ST30-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGKAWPRRAVGTAGGPCAEQISAPFQTLLM

Note: No experimental confirmation available.

Show »
Length:1,093
Mass (Da):121,543
Checksum:i6CE3ECF0345D3D78
GO

Sequence cautioni

The sequence BAD92716.1 differs from that shown. Reason: The sequence differs from that shown because it seems to be derived from a pre-mRNA.
The sequence BAB15191.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAB67778.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence CAM24842.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAM25404.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAQ06763.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAQ09774.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAQ10925.1 differs from that shown. Reason: Erroneous gene model prediction.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti25 – 251F → S in BAG65557. (PubMed:14702039)Curated
Sequence conflicti156 – 1561H → R in BAG57195. (PubMed:14702039)Curated
Sequence conflicti985 – 9851E → G in BAB15191. (PubMed:14702039)Curated
Sequence conflicti1060 – 10601S → G in BAG65557. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti26 – 261H → Y.
Corresponds to variant rs6926224 [ dbSNP | Ensembl ].
VAR_052651
Natural varianti64 – 641G → R.
Corresponds to variant rs6926723 [ dbSNP | Ensembl ].
VAR_043730
Natural varianti449 – 4491W → R.4 Publications
Corresponds to variant rs2249464 [ dbSNP | Ensembl ].
VAR_043731
Natural varianti680 – 6801V → L.4 Publications
Corresponds to variant rs2074506 [ dbSNP | Ensembl ].
VAR_043732
Natural varianti765 – 7651V → M.
Corresponds to variant rs55865499 [ dbSNP | Ensembl ].
VAR_061910
Natural varianti917 – 9171R → Q.3 Publications
Corresponds to variant rs9394021 [ dbSNP | Ensembl ].
VAR_043733
Natural varianti965 – 9651A → T.5 Publications
Corresponds to variant rs2252863 [ dbSNP | Ensembl ].
VAR_043734
Natural varianti1049 – 10491R → Q.3 Publications
Corresponds to variant rs4678 [ dbSNP | Ensembl ].
VAR_043735

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 644644MPHLP…LPFSK → MVFFCPVPLFCPGLAPRDPR PCSFLPPVTFGNGQRPSAVL GGPHGHVGDPAHRAAALQQV WRPEIPRHLQGNPPLLTPPC PQ in isoform 2. 1 PublicationVSP_034032Add
BLAST
Alternative sequencei1 – 140140Missing in isoform 3. 1 PublicationVSP_045483Add
BLAST
Alternative sequencei1 – 11M → MGGKAWPRRAVGTAGGPCAE QISAPFQTLLM in isoform 4. 1 PublicationVSP_046102

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB067472 mRNA. Translation: BAB67778.1. Different initiation.
AK025618 mRNA. Translation: BAB15191.1. Different initiation.
AK125069 mRNA. No translation available.
AK293780 mRNA. Translation: BAG57195.1.
AK304807 mRNA. Translation: BAG65557.1.
AB209479 Transcribed RNA. Translation: BAD92716.1. Sequence problems.
AL662854 Genomic DNA. Translation: CAI17437.1.
AL662854 Genomic DNA. Translation: CAM24842.1. Sequence problems.
AL669830 Genomic DNA. Translation: CAI18004.1.
AL669830 Genomic DNA. Translation: CAM25404.1. Sequence problems.
AL773541 Genomic DNA. Translation: CAI18453.1.
BX927194 Genomic DNA. Translation: CAQ09774.1. Sequence problems.
BX927194 Genomic DNA. Translation: CAQ09775.1.
CR759747 Genomic DNA. Translation: CAQ06763.1. Sequence problems.
CR759747 Genomic DNA. Translation: CAQ06764.1.
CR936875 Genomic DNA. Translation: CAQ10925.1. Sequence problems.
CR936875 Genomic DNA. Translation: CAQ10926.1.
BC008844 mRNA. Translation: AAH08844.2.
BC009355 mRNA. Translation: AAH09355.2.
BC073838 mRNA. Translation: AAH73838.1.
BC112054 mRNA. Translation: AAI12055.1.
BC113605 mRNA. Translation: AAI13606.1.
AL122037 mRNA. Translation: CAB59177.1.
CCDSiCCDS34387.1. [Q5ST30-1]
CCDS54980.1. [Q5ST30-4]
RefSeqiNP_001161205.1. NM_001167733.2. [Q5ST30-3]
NP_001161206.1. NM_001167734.1. [Q5ST30-4]
NP_065175.4. NM_020442.5. [Q5ST30-1]
UniGeneiHs.597526.

Genome annotation databases

EnsembliENST00000321897; ENSP00000316092; ENSG00000137411. [Q5ST30-1]
ENST00000541562; ENSP00000441000; ENSG00000137411. [Q5ST30-4]
GeneIDi57176.
KEGGihsa:57176.
UCSCiuc003nsc.2. human. [Q5ST30-1]
uc010jsg.2. human. [Q5ST30-2]
uc011dmz.2. human.

Polymorphism databases

DMDMi296452917.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB067472 mRNA. Translation: BAB67778.1 . Different initiation.
AK025618 mRNA. Translation: BAB15191.1 . Different initiation.
AK125069 mRNA. No translation available.
AK293780 mRNA. Translation: BAG57195.1 .
AK304807 mRNA. Translation: BAG65557.1 .
AB209479 Transcribed RNA. Translation: BAD92716.1 . Sequence problems.
AL662854 Genomic DNA. Translation: CAI17437.1 .
AL662854 Genomic DNA. Translation: CAM24842.1 . Sequence problems.
AL669830 Genomic DNA. Translation: CAI18004.1 .
AL669830 Genomic DNA. Translation: CAM25404.1 . Sequence problems.
AL773541 Genomic DNA. Translation: CAI18453.1 .
BX927194 Genomic DNA. Translation: CAQ09774.1 . Sequence problems.
BX927194 Genomic DNA. Translation: CAQ09775.1 .
CR759747 Genomic DNA. Translation: CAQ06763.1 . Sequence problems.
CR759747 Genomic DNA. Translation: CAQ06764.1 .
CR936875 Genomic DNA. Translation: CAQ10925.1 . Sequence problems.
CR936875 Genomic DNA. Translation: CAQ10926.1 .
BC008844 mRNA. Translation: AAH08844.2 .
BC009355 mRNA. Translation: AAH09355.2 .
BC073838 mRNA. Translation: AAH73838.1 .
BC112054 mRNA. Translation: AAI12055.1 .
BC113605 mRNA. Translation: AAI13606.1 .
AL122037 mRNA. Translation: CAB59177.1 .
CCDSi CCDS34387.1. [Q5ST30-1 ]
CCDS54980.1. [Q5ST30-4 ]
RefSeqi NP_001161205.1. NM_001167733.2. [Q5ST30-3 ]
NP_001161206.1. NM_001167734.1. [Q5ST30-4 ]
NP_065175.4. NM_020442.5. [Q5ST30-1 ]
UniGenei Hs.597526.

3D structure databases

ProteinModelPortali Q5ST30.
SMRi Q5ST30. Positions 100-945.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121426. 4 interactions.
IntActi Q5ST30. 2 interactions.
MINTi MINT-8052670.
STRINGi 9606.ENSP00000408337.

PTM databases

PhosphoSitei Q5ST30.

Polymorphism databases

DMDMi 296452917.

Proteomic databases

MaxQBi Q5ST30.
PaxDbi Q5ST30.
PRIDEi Q5ST30.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000321897 ; ENSP00000316092 ; ENSG00000137411 . [Q5ST30-1 ]
ENST00000541562 ; ENSP00000441000 ; ENSG00000137411 . [Q5ST30-4 ]
GeneIDi 57176.
KEGGi hsa:57176.
UCSCi uc003nsc.2. human. [Q5ST30-1 ]
uc010jsg.2. human. [Q5ST30-2 ]
uc011dmz.2. human.

Organism-specific databases

CTDi 57176.
GeneCardsi GC06P030876.
H-InvDB HIX0166334.
HIX0166693.
HIX0200924.
HGNCi HGNC:21642. VARS2.
MIMi 612802. gene.
neXtProti NX_Q5ST30.
PharmGKBi PA164742816.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0525.
GeneTreei ENSGT00550000074727.
HOVERGENi HBG017878.
InParanoidi Q5ST30.
KOi K01873.
OMAi CEEISAE.
OrthoDBi EOG7DZ8J5.
PhylomeDBi Q5ST30.
TreeFami TF354250.

Enzyme and pathway databases

Reactomei REACT_15302. Mitochondrial tRNA aminoacylation.

Miscellaneous databases

ChiTaRSi VARS2. human.
GenomeRNAii 57176.
NextBioi 63203.
PROi Q5ST30.
SOURCEi Search...

Gene expression databases

Bgeei Q5ST30.
CleanExi HS_VARS2.
ExpressionAtlasi Q5ST30. baseline and differential.
Genevestigatori Q5ST30.

Family and domain databases

Gene3Di 1.10.730.10. 1 hit.
3.40.50.620. 3 hits.
3.90.740.10. 1 hit.
InterProi IPR001412. aa-tRNA-synth_I_CS.
IPR002300. aa-tRNA-synth_Ia.
IPR014729. Rossmann-like_a/b/a_fold.
IPR009080. tRNAsynth_1a_anticodon-bd.
IPR013155. V/L/I-tRNA-synth_anticodon-bd.
IPR009008. Val/Leu/Ile-tRNA-synth_edit.
IPR002303. Valyl-tRNA_ligase.
[Graphical view ]
Pfami PF08264. Anticodon_1. 1 hit.
PF00133. tRNA-synt_1. 1 hit.
[Graphical view ]
PRINTSi PR00986. TRNASYNTHVAL.
SUPFAMi SSF47323. SSF47323. 1 hit.
SSF50677. SSF50677. 1 hit.
TIGRFAMsi TIGR00422. valS. 1 hit.
PROSITEi PS00178. AA_TRNA_LIGASE_I. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins."
    Nagase T., Kikuno R., Ohara O.
    DNA Res. 8:179-187(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLN-1049.
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 416-1063 (ISOFORM 1), VARIANTS ARG-449; LEU-680; GLN-917 AND THR-965.
    Tissue: Cerebellum, Thalamus and Uterus.
  3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ARG-449; LEU-680 AND THR-965.
    Tissue: Brain.
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS ARG-449; LEU-680; GLN-917; THR-965 AND GLN-1049.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ARG-449; LEU-680; GLN-917; THR-965 AND GLN-1049.
    Tissue: Brain, Eye and Skin.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 748-1063 (ISOFORM 1), VARIANT THR-965.
    Tissue: Testis.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSYVM_HUMAN
AccessioniPrimary (citable) accession number: Q5ST30
Secondary accession number(s): A2ABL7
, B4DET4, B4E3P5, F5GXJ0, F5H323, Q2M2A0, Q59FI1, Q5SQ96, Q5SS98, Q6DKJ5, Q6ZV24, Q96GN2, Q96H77, Q96Q02, Q9H6R2, Q9UFH7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: May 18, 2010
Last modified: October 29, 2014
This is version 106 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Aminoacyl-tRNA synthetases
    List of aminoacyl-tRNA synthetase entries
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3