Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5SSQ6

- SAPC1_HUMAN

UniProt

Q5SSQ6 - SAPC1_HUMAN

Protein

Suppressor APC domain-containing protein 1

Gene

SAPCD1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
  1. Names & Taxonomyi

    Protein namesi
    Recommended name:
    Suppressor APC domain-containing protein 1
    Alternative name(s):
    Protein G7d
    Gene namesi
    Name:SAPCD1
    Synonyms:C6orf26, G7D, NG23
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:13938. SAPCD1.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134974558.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 148148Suppressor APC domain-containing protein 1PRO_0000244082Add
    BLAST

    Proteomic databases

    PaxDbiQ5SSQ6.
    PRIDEiQ5SSQ6.

    Expressioni

    Gene expression databases

    BgeeiQ5SSQ6.
    CleanExiHS_C6orf26.
    GenevestigatoriQ5SSQ6.

    Interactioni

    Protein-protein interaction databases

    BioGridi134996. 1 interaction.
    STRINGi9606.ENSP00000403346.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5SSQ6.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Phylogenomic databases

    eggNOGiNOG75708.
    HOGENOMiHOG000231231.
    HOVERGENiHBG057982.
    OMAiLEHGQAW.
    PhylomeDBiQ5SSQ6.
    TreeFamiTF324086.

    Family and domain databases

    InterProiIPR026831. APC_dom.
    IPR026828. Suppressor_APCD_1/2.
    [Graphical view]
    PANTHERiPTHR14907. PTHR14907. 1 hit.
    PfamiPF11414. Suppressor_APC. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5SSQ6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGSQGSGGVP LVQAPYTVLL LPLGTSRQDP GAQSFFLWLR RMQALEREQD    50
    ALWQGLELLQ HGQAWFEDHL REAQRQQLHL GALGENFLTD LHSEPGRPPL 100
    AQIQKVNICL QNLIHEKELS RQQKGVTQPK EEMAQRGCTK GPRGPTRV 148
    Length:148
    Mass (Da):16,650
    Last modified:June 27, 2006 - v2
    Checksum:i6311AF525675DDFF
    GO
    Isoform 2 (identifier: Q5SSQ6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         117-117: K → KFSPSPLNKASSCTTQDSKERRREQNLWQQQ

    Show »
    Length:178
    Mass (Da):20,183
    Checksum:i32A02509CC44E793
    GO

    Sequence cautioni

    The sequence CAI18428.2 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAM24986.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAM26109.1 differs from that shown. Reason: Erroneous gene model prediction.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti30 – 301P → S.
    Corresponds to variant rs17201151 [ dbSNP | Ensembl ].
    VAR_056889
    Natural varianti99 – 991P → L.
    Corresponds to variant rs6905572 [ dbSNP | Ensembl ].
    VAR_056890

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei117 – 1171K → KFSPSPLNKASSCTTQDSKE RRREQNLWQQQ in isoform 2. 1 PublicationVSP_040223

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF134726 Genomic DNA. Translation: AAD21821.1.
    BA000025 Genomic DNA. Translation: BAB63305.1.
    AL662834 Genomic DNA. Translation: CAI17728.1.
    AL662834 Genomic DNA. Translation: CAM24986.1. Sequence problems.
    AL662899 Genomic DNA. Translation: CAI18428.2. Sequence problems.
    AL662899 Genomic DNA. Translation: CAM25673.1.
    BX248133 Genomic DNA. Translation: CAM26109.1. Sequence problems.
    BX248133 Genomic DNA. Translation: CAM26110.1.
    CR759787 Genomic DNA. Translation: CAQ10123.1.
    CR759915 Genomic DNA. Translation: CAQ07250.1.
    CR925765 Genomic DNA. Translation: CAQ10617.1.
    BC137541 mRNA. Translation: AAI37542.1.
    BC137542 mRNA. Translation: AAI37543.1.
    CCDSiCCDS34411.1. [Q5SSQ6-2]
    RefSeqiNP_001034740.1. NM_001039651.1. [Q5SSQ6-2]
    UniGeneiHs.371225.

    Genome annotation databases

    EnsembliENST00000415669; ENSP00000411948; ENSG00000228727. [Q5SSQ6-2]
    ENST00000443153; ENSP00000403687; ENSG00000227074. [Q5SSQ6-2]
    ENST00000447852; ENSP00000403346; ENSG00000227861. [Q5SSQ6-2]
    ENST00000449857; ENSP00000387942; ENSG00000237918. [Q5SSQ6-2]
    ENST00000453534; ENSP00000404105; ENSG00000234951. [Q5SSQ6-2]
    ENST00000457185; ENSP00000405513; ENSG00000229176. [Q5SSQ6-2]
    ENST00000548987; ENSP00000448208; ENSG00000227074. [Q5SSQ6-1]
    ENST00000551778; ENSP00000450257; ENSG00000234951. [Q5SSQ6-1]
    GeneIDi401251.
    KEGGihsa:401251.
    UCSCiuc003nwz.4. human. [Q5SSQ6-2]

    Polymorphism databases

    DMDMi109829408.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF134726 Genomic DNA. Translation: AAD21821.1 .
    BA000025 Genomic DNA. Translation: BAB63305.1 .
    AL662834 Genomic DNA. Translation: CAI17728.1 .
    AL662834 Genomic DNA. Translation: CAM24986.1 . Sequence problems.
    AL662899 Genomic DNA. Translation: CAI18428.2 . Sequence problems.
    AL662899 Genomic DNA. Translation: CAM25673.1 .
    BX248133 Genomic DNA. Translation: CAM26109.1 . Sequence problems.
    BX248133 Genomic DNA. Translation: CAM26110.1 .
    CR759787 Genomic DNA. Translation: CAQ10123.1 .
    CR759915 Genomic DNA. Translation: CAQ07250.1 .
    CR925765 Genomic DNA. Translation: CAQ10617.1 .
    BC137541 mRNA. Translation: AAI37542.1 .
    BC137542 mRNA. Translation: AAI37543.1 .
    CCDSi CCDS34411.1. [Q5SSQ6-2 ]
    RefSeqi NP_001034740.1. NM_001039651.1. [Q5SSQ6-2 ]
    UniGenei Hs.371225.

    3D structure databases

    ProteinModelPortali Q5SSQ6.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 134996. 1 interaction.
    STRINGi 9606.ENSP00000403346.

    Polymorphism databases

    DMDMi 109829408.

    Proteomic databases

    PaxDbi Q5SSQ6.
    PRIDEi Q5SSQ6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000415669 ; ENSP00000411948 ; ENSG00000228727 . [Q5SSQ6-2 ]
    ENST00000443153 ; ENSP00000403687 ; ENSG00000227074 . [Q5SSQ6-2 ]
    ENST00000447852 ; ENSP00000403346 ; ENSG00000227861 . [Q5SSQ6-2 ]
    ENST00000449857 ; ENSP00000387942 ; ENSG00000237918 . [Q5SSQ6-2 ]
    ENST00000453534 ; ENSP00000404105 ; ENSG00000234951 . [Q5SSQ6-2 ]
    ENST00000457185 ; ENSP00000405513 ; ENSG00000229176 . [Q5SSQ6-2 ]
    ENST00000548987 ; ENSP00000448208 ; ENSG00000227074 . [Q5SSQ6-1 ]
    ENST00000551778 ; ENSP00000450257 ; ENSG00000234951 . [Q5SSQ6-1 ]
    GeneIDi 401251.
    KEGGi hsa:401251.
    UCSCi uc003nwz.4. human. [Q5SSQ6-2 ]

    Organism-specific databases

    CTDi 401251.
    GeneCardsi GC06P031748.
    GC06Pi31741.
    GC06Pj31717.
    GC06Pk31712.
    GC06Pm31806.
    GC06Po31720.
    HGNCi HGNC:13938. SAPCD1.
    neXtProti NX_Q5SSQ6.
    PharmGKBi PA134974558.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG75708.
    HOGENOMi HOG000231231.
    HOVERGENi HBG057982.
    OMAi LEHGQAW.
    PhylomeDBi Q5SSQ6.
    TreeFami TF324086.

    Miscellaneous databases

    GenomeRNAii 401251.
    NextBioi 106660.
    PROi Q5SSQ6.

    Gene expression databases

    Bgeei Q5SSQ6.
    CleanExi HS_C6orf26.
    Genevestigatori Q5SSQ6.

    Family and domain databases

    InterProi IPR026831. APC_dom.
    IPR026828. Suppressor_APCD_1/2.
    [Graphical view ]
    PANTHERi PTHR14907. PTHR14907. 1 hit.
    Pfami PF11414. Suppressor_APC. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse."
      Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L.
      Genome Res. 13:2621-2636(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. "Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region."
      Shiina S., Tamiya G., Oka A., Inoko H.
      Submitted (DEC-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

    Entry informationi

    Entry nameiSAPC1_HUMAN
    AccessioniPrimary (citable) accession number: Q5SSQ6
    Secondary accession number(s): A2ABF2, A2ABS9, Q9Y335
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 27, 2006
    Last sequence update: June 27, 2006
    Last modified: October 1, 2014
    This is version 73 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations

    External Data

    Dasty 3