Q5SSQ6 (SAPC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 62.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Suppressor APC domain-containing protein 1 Alternative name(s): Protein G7d | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 148 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence caution | The sequence CAI18428.2 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAM24986.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAM26109.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5SSQ6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5SSQ6-2) The sequence of this isoform differs from the canonical sequence as follows: 117-117: K → KFSPSPLNKASSCTTQDSKERRREQNLWQQQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 148 | 148 | Suppressor APC domain-containing protein 1 | PRO_0000244082 | |||||
Natural variations | |||||||||
| Alternative sequence | 117 | 1 | K → KFSPSPLNKASSCTTQDSKE RRREQNLWQQQ in isoform 2. | VSP_040223 | |||||
| Natural variant | 30 | 1 | P → S. Corresponds to variant rs17201151 [ dbSNP | Ensembl ]. | VAR_056889 | |||||
| Natural variant | 99 | 1 | P → L. Corresponds to variant rs6905572 [ dbSNP | Ensembl ]. | VAR_056890 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse." Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L. Genome Res. 13:2621-2636(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region." Shiina S., Tamiya G., Oka A., Inoko H. Submitted (DEC-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF134726 Genomic DNA. Translation: AAD21821.1. BA000025 Genomic DNA. Translation: BAB63305.1. AL662834 Genomic DNA. Translation: CAI17728.1. AL662834 Genomic DNA. Translation: CAM24986.1. Sequence problems. AL662899 Genomic DNA. Translation: CAI18428.2. Sequence problems. AL662899 Genomic DNA. Translation: CAM25673.1. BX248133 Genomic DNA. Translation: CAM26109.1. Sequence problems. BX248133 Genomic DNA. Translation: CAM26110.1. CR759787 Genomic DNA. Translation: CAQ10123.1. CR759915 Genomic DNA. Translation: CAQ07250.1. CR925765 Genomic DNA. Translation: CAQ10617.1. BC137541 mRNA. Translation: AAI37542.1. BC137542 mRNA. Translation: AAI37543.1. |
| IPI | IPI00019313. IPI00513990. |
| RefSeq | NP_001034740.1. NM_001039651.1. |
| UniGene | Hs.371225. |
3D structure databases | |
| ProteinModelPortal | Q5SSQ6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000387942. |
Polymorphism databases | |
| DMDM | 109829408. |
Proteomic databases | |
| PaxDb | Q5SSQ6. |
| PRIDE | Q5SSQ6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000415669; ENSP00000411948; ENSG00000228727. ENST00000425424; ENSP00000413372; ENSG00000228727. ENST00000443153; ENSP00000403687; ENSG00000227074. ENST00000447852; ENSP00000403346; ENSG00000227861. ENST00000449857; ENSP00000387942; ENSG00000237918. ENST00000453534; ENSP00000404105; ENSG00000234951. ENST00000457185; ENSP00000405513; ENSG00000229176. ENST00000547662; ENSP00000447344; ENSG00000229176. ENST00000548003; ENSP00000450332; ENSG00000237918. ENST00000548987; ENSP00000448208; ENSG00000227074. ENST00000551778; ENSP00000450257; ENSG00000234951. ENST00000552302; ENSP00000446749; ENSG00000227861. |
| GeneID | 401251. |
| KEGG | hsa:401251. |
| UCSC | uc003nwz.4. human. |
Organism-specific databases | |
| CTD | 401251. |
| GeneCards | GC06P031732. |
| HGNC | HGNC:13938. SAPCD1. |
| neXtProt | NX_Q5SSQ6. |
| PharmGKB | PA134974558. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG75708. |
| HOGENOM | HOG000231231. |
| HOVERGEN | HBG057982. |
| OMA | PLETSRQ. |
| OrthoDB | EOG4R503V. |
Gene expression databases | |
| ArrayExpress | Q5SSQ6. |
| Bgee | Q5SSQ6. |
| CleanEx | HS_C6orf26. |
| Genevestigator | Q5SSQ6. |
| GermOnline | ENSG00000204410. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR026831. APC_dom. IPR026828. Suppressor_APCD_1/2. [Graphical view] |
| PANTHER | PTHR14907. PTHR14907. 1 hit. |
| Pfam | PF11414. Suppressor_APC. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 401251. |
| NextBio | 106660. |
Entry information
| Entry name | SAPC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5SSQ6 Secondary accession number(s): A2ABF2, A2ABS9, Q9Y335 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with
