SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5SSQ6

- SAPC1_HUMAN

UniProt

Q5SSQ6 - SAPC1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Suppressor APC domain-containing protein 1
Gene
SAPCD1, C6orf26, G7D, NG23
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Suppressor APC domain-containing protein 1
Alternative name(s):
Protein G7d
Gene namesi
Name:SAPCD1
Synonyms:C6orf26, G7D, NG23
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:13938. SAPCD1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134974558.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 148148Suppressor APC domain-containing protein 1
PRO_0000244082Add
BLAST

Proteomic databases

PaxDbiQ5SSQ6.
PRIDEiQ5SSQ6.

Expressioni

Gene expression databases

BgeeiQ5SSQ6.
CleanExiHS_C6orf26.
GenevestigatoriQ5SSQ6.

Interactioni

Protein-protein interaction databases

BioGridi134996. 1 interaction.
STRINGi9606.ENSP00000403346.

Structurei

3D structure databases

ProteinModelPortaliQ5SSQ6.

Family & Domainsi

Phylogenomic databases

eggNOGiNOG75708.
HOGENOMiHOG000231231.
HOVERGENiHBG057982.
OMAiLEHGQAW.
PhylomeDBiQ5SSQ6.
TreeFamiTF324086.

Family and domain databases

InterProiIPR026831. APC_dom.
IPR026828. Suppressor_APCD_1/2.
[Graphical view]
PANTHERiPTHR14907. PTHR14907. 1 hit.
PfamiPF11414. Suppressor_APC. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5SSQ6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGSQGSGGVP LVQAPYTVLL LPLGTSRQDP GAQSFFLWLR RMQALEREQD    50
ALWQGLELLQ HGQAWFEDHL REAQRQQLHL GALGENFLTD LHSEPGRPPL 100
AQIQKVNICL QNLIHEKELS RQQKGVTQPK EEMAQRGCTK GPRGPTRV 148
Length:148
Mass (Da):16,650
Last modified:June 27, 2006 - v2
Checksum:i6311AF525675DDFF
GO
Isoform 2 (identifier: Q5SSQ6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: K → KFSPSPLNKASSCTTQDSKERRREQNLWQQQ

Show »
Length:178
Mass (Da):20,183
Checksum:i32A02509CC44E793
GO

Sequence cautioni

The sequence CAI18428.2 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAM24986.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAM26109.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti30 – 301P → S.
Corresponds to variant rs17201151 [ dbSNP | Ensembl ].
VAR_056889
Natural varianti99 – 991P → L.
Corresponds to variant rs6905572 [ dbSNP | Ensembl ].
VAR_056890

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei117 – 1171K → KFSPSPLNKASSCTTQDSKE RRREQNLWQQQ in isoform 2.
VSP_040223

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF134726 Genomic DNA. Translation: AAD21821.1.
BA000025 Genomic DNA. Translation: BAB63305.1.
AL662834 Genomic DNA. Translation: CAI17728.1.
AL662834 Genomic DNA. Translation: CAM24986.1. Sequence problems.
AL662899 Genomic DNA. Translation: CAI18428.2. Sequence problems.
AL662899 Genomic DNA. Translation: CAM25673.1.
BX248133 Genomic DNA. Translation: CAM26109.1. Sequence problems.
BX248133 Genomic DNA. Translation: CAM26110.1.
CR759787 Genomic DNA. Translation: CAQ10123.1.
CR759915 Genomic DNA. Translation: CAQ07250.1.
CR925765 Genomic DNA. Translation: CAQ10617.1.
BC137541 mRNA. Translation: AAI37542.1.
BC137542 mRNA. Translation: AAI37543.1.
CCDSiCCDS34411.1. [Q5SSQ6-2]
RefSeqiNP_001034740.1. NM_001039651.1. [Q5SSQ6-2]
UniGeneiHs.371225.

Genome annotation databases

EnsembliENST00000415669; ENSP00000411948; ENSG00000228727. [Q5SSQ6-2]
ENST00000425424; ENSP00000413372; ENSG00000228727. [Q5SSQ6-1]
ENST00000443153; ENSP00000403687; ENSG00000227074. [Q5SSQ6-2]
ENST00000447852; ENSP00000403346; ENSG00000227861. [Q5SSQ6-2]
ENST00000449857; ENSP00000387942; ENSG00000237918. [Q5SSQ6-2]
ENST00000453534; ENSP00000404105; ENSG00000234951. [Q5SSQ6-2]
ENST00000457185; ENSP00000405513; ENSG00000229176. [Q5SSQ6-2]
ENST00000547662; ENSP00000447344; ENSG00000229176. [Q5SSQ6-1]
ENST00000548003; ENSP00000450332; ENSG00000237918. [Q5SSQ6-1]
ENST00000548987; ENSP00000448208; ENSG00000227074. [Q5SSQ6-1]
ENST00000551778; ENSP00000450257; ENSG00000234951. [Q5SSQ6-1]
ENST00000552302; ENSP00000446749; ENSG00000227861. [Q5SSQ6-1]
GeneIDi401251.
KEGGihsa:401251.
UCSCiuc003nwz.4. human. [Q5SSQ6-2]

Polymorphism databases

DMDMi109829408.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF134726 Genomic DNA. Translation: AAD21821.1 .
BA000025 Genomic DNA. Translation: BAB63305.1 .
AL662834 Genomic DNA. Translation: CAI17728.1 .
AL662834 Genomic DNA. Translation: CAM24986.1 . Sequence problems.
AL662899 Genomic DNA. Translation: CAI18428.2 . Sequence problems.
AL662899 Genomic DNA. Translation: CAM25673.1 .
BX248133 Genomic DNA. Translation: CAM26109.1 . Sequence problems.
BX248133 Genomic DNA. Translation: CAM26110.1 .
CR759787 Genomic DNA. Translation: CAQ10123.1 .
CR759915 Genomic DNA. Translation: CAQ07250.1 .
CR925765 Genomic DNA. Translation: CAQ10617.1 .
BC137541 mRNA. Translation: AAI37542.1 .
BC137542 mRNA. Translation: AAI37543.1 .
CCDSi CCDS34411.1. [Q5SSQ6-2 ]
RefSeqi NP_001034740.1. NM_001039651.1. [Q5SSQ6-2 ]
UniGenei Hs.371225.

3D structure databases

ProteinModelPortali Q5SSQ6.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 134996. 1 interaction.
STRINGi 9606.ENSP00000403346.

Polymorphism databases

DMDMi 109829408.

Proteomic databases

PaxDbi Q5SSQ6.
PRIDEi Q5SSQ6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000415669 ; ENSP00000411948 ; ENSG00000228727 . [Q5SSQ6-2 ]
ENST00000425424 ; ENSP00000413372 ; ENSG00000228727 . [Q5SSQ6-1 ]
ENST00000443153 ; ENSP00000403687 ; ENSG00000227074 . [Q5SSQ6-2 ]
ENST00000447852 ; ENSP00000403346 ; ENSG00000227861 . [Q5SSQ6-2 ]
ENST00000449857 ; ENSP00000387942 ; ENSG00000237918 . [Q5SSQ6-2 ]
ENST00000453534 ; ENSP00000404105 ; ENSG00000234951 . [Q5SSQ6-2 ]
ENST00000457185 ; ENSP00000405513 ; ENSG00000229176 . [Q5SSQ6-2 ]
ENST00000547662 ; ENSP00000447344 ; ENSG00000229176 . [Q5SSQ6-1 ]
ENST00000548003 ; ENSP00000450332 ; ENSG00000237918 . [Q5SSQ6-1 ]
ENST00000548987 ; ENSP00000448208 ; ENSG00000227074 . [Q5SSQ6-1 ]
ENST00000551778 ; ENSP00000450257 ; ENSG00000234951 . [Q5SSQ6-1 ]
ENST00000552302 ; ENSP00000446749 ; ENSG00000227861 . [Q5SSQ6-1 ]
GeneIDi 401251.
KEGGi hsa:401251.
UCSCi uc003nwz.4. human. [Q5SSQ6-2 ]

Organism-specific databases

CTDi 401251.
GeneCardsi GC06P031748.
GC06Pi31741.
GC06Pj31717.
GC06Pk31712.
GC06Pm31806.
GC06Po31720.
HGNCi HGNC:13938. SAPCD1.
neXtProti NX_Q5SSQ6.
PharmGKBi PA134974558.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG75708.
HOGENOMi HOG000231231.
HOVERGENi HBG057982.
OMAi LEHGQAW.
PhylomeDBi Q5SSQ6.
TreeFami TF324086.

Miscellaneous databases

GenomeRNAii 401251.
NextBioi 106660.
PROi Q5SSQ6.

Gene expression databases

Bgeei Q5SSQ6.
CleanExi HS_C6orf26.
Genevestigatori Q5SSQ6.

Family and domain databases

InterProi IPR026831. APC_dom.
IPR026828. Suppressor_APCD_1/2.
[Graphical view ]
PANTHERi PTHR14907. PTHR14907. 1 hit.
Pfami PF11414. Suppressor_APC. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse."
    Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L.
    Genome Res. 13:2621-2636(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region."
    Shiina S., Tamiya G., Oka A., Inoko H.
    Submitted (DEC-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

Entry informationi

Entry nameiSAPC1_HUMAN
AccessioniPrimary (citable) accession number: Q5SSQ6
Secondary accession number(s): A2ABF2, A2ABS9, Q9Y335
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: July 9, 2014
This is version 72 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

External Data

Dasty 3

Similar proteinsi