Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Suppressor APC domain-containing protein 1

Gene

SAPCD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Suppressor APC domain-containing protein 1
Alternative name(s):
Protein G7d
Gene namesi
Name:SAPCD1
Synonyms:C6orf26, G7D, NG23
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:13938. SAPCD1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134974558.

Polymorphism and mutation databases

BioMutaiSAPCD1.
DMDMi109829408.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 148148Suppressor APC domain-containing protein 1PRO_0000244082Add
BLAST

Proteomic databases

PaxDbiQ5SSQ6.
PRIDEiQ5SSQ6.

Expressioni

Gene expression databases

BgeeiQ5SSQ6.
CleanExiHS_C6orf26.
ExpressionAtlasiQ5SSQ6. baseline.
GenevisibleiQ5SSQ6. HS.

Interactioni

Protein-protein interaction databases

BioGridi134996. 6 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ5SSQ6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiNOG75708.
GeneTreeiENSGT00500000045192.
ENSGT00550000074977.
HOGENOMiHOG000231231.
HOVERGENiHBG057982.
InParanoidiQ5SSQ6.
OMAiLEHGQAW.
PhylomeDBiQ5SSQ6.
TreeFamiTF324086.

Family and domain databases

InterProiIPR026831. APC_dom.
IPR026828. Suppressor_APCD_1/2.
[Graphical view]
PANTHERiPTHR14907. PTHR14907. 1 hit.
PfamiPF11414. Suppressor_APC. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5SSQ6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSQGSGGVP LVQAPYTVLL LPLGTSRQDP GAQSFFLWLR RMQALEREQD
60 70 80 90 100
ALWQGLELLQ HGQAWFEDHL REAQRQQLHL GALGENFLTD LHSEPGRPPL
110 120 130 140
AQIQKVNICL QNLIHEKELS RQQKGVTQPK EEMAQRGCTK GPRGPTRV
Length:148
Mass (Da):16,650
Last modified:June 27, 2006 - v2
Checksum:i6311AF525675DDFF
GO
Isoform 2 (identifier: Q5SSQ6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: K → KFSPSPLNKASSCTTQDSKERRREQNLWQQQ

Show »
Length:178
Mass (Da):20,183
Checksum:i32A02509CC44E793
GO

Sequence cautioni

The sequence CAI18428.2 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAM24986.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAM26109.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti30 – 301P → S.
Corresponds to variant rs17201151 [ dbSNP | Ensembl ].
VAR_056889
Natural varianti99 – 991P → L.
Corresponds to variant rs6905572 [ dbSNP | Ensembl ].
VAR_056890

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei117 – 1171K → KFSPSPLNKASSCTTQDSKE RRREQNLWQQQ in isoform 2. 1 PublicationVSP_040223

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF134726 Genomic DNA. Translation: AAD21821.1.
BA000025 Genomic DNA. Translation: BAB63305.1.
AL662834 Genomic DNA. Translation: CAI17728.1.
AL662834 Genomic DNA. Translation: CAM24986.1. Sequence problems.
AL662899 Genomic DNA. Translation: CAI18428.2. Sequence problems.
AL662899 Genomic DNA. Translation: CAM25673.1.
BX248133 Genomic DNA. Translation: CAM26109.1. Sequence problems.
BX248133 Genomic DNA. Translation: CAM26110.1.
CR759787 Genomic DNA. Translation: CAQ10123.1.
CR759915 Genomic DNA. Translation: CAQ07250.1.
CR925765 Genomic DNA. Translation: CAQ10617.1.
BC137541 mRNA. Translation: AAI37542.1.
BC137542 mRNA. Translation: AAI37543.1.
CCDSiCCDS34411.1. [Q5SSQ6-2]
RefSeqiNP_001034740.1. NM_001039651.1. [Q5SSQ6-2]
UniGeneiHs.371225.

Genome annotation databases

EnsembliENST00000415669; ENSP00000411948; ENSG00000228727. [Q5SSQ6-2]
ENST00000443153; ENSP00000403687; ENSG00000227074. [Q5SSQ6-2]
ENST00000447852; ENSP00000403346; ENSG00000227861. [Q5SSQ6-2]
ENST00000449857; ENSP00000387942; ENSG00000237918. [Q5SSQ6-2]
ENST00000453534; ENSP00000404105; ENSG00000234951. [Q5SSQ6-2]
ENST00000457185; ENSP00000405513; ENSG00000229176. [Q5SSQ6-2]
GeneIDi401251.
KEGGihsa:401251.
UCSCiuc003nwz.4. human. [Q5SSQ6-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF134726 Genomic DNA. Translation: AAD21821.1.
BA000025 Genomic DNA. Translation: BAB63305.1.
AL662834 Genomic DNA. Translation: CAI17728.1.
AL662834 Genomic DNA. Translation: CAM24986.1. Sequence problems.
AL662899 Genomic DNA. Translation: CAI18428.2. Sequence problems.
AL662899 Genomic DNA. Translation: CAM25673.1.
BX248133 Genomic DNA. Translation: CAM26109.1. Sequence problems.
BX248133 Genomic DNA. Translation: CAM26110.1.
CR759787 Genomic DNA. Translation: CAQ10123.1.
CR759915 Genomic DNA. Translation: CAQ07250.1.
CR925765 Genomic DNA. Translation: CAQ10617.1.
BC137541 mRNA. Translation: AAI37542.1.
BC137542 mRNA. Translation: AAI37543.1.
CCDSiCCDS34411.1. [Q5SSQ6-2]
RefSeqiNP_001034740.1. NM_001039651.1. [Q5SSQ6-2]
UniGeneiHs.371225.

3D structure databases

ProteinModelPortaliQ5SSQ6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi134996. 6 interactions.

Polymorphism and mutation databases

BioMutaiSAPCD1.
DMDMi109829408.

Proteomic databases

PaxDbiQ5SSQ6.
PRIDEiQ5SSQ6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000415669; ENSP00000411948; ENSG00000228727. [Q5SSQ6-2]
ENST00000443153; ENSP00000403687; ENSG00000227074. [Q5SSQ6-2]
ENST00000447852; ENSP00000403346; ENSG00000227861. [Q5SSQ6-2]
ENST00000449857; ENSP00000387942; ENSG00000237918. [Q5SSQ6-2]
ENST00000453534; ENSP00000404105; ENSG00000234951. [Q5SSQ6-2]
ENST00000457185; ENSP00000405513; ENSG00000229176. [Q5SSQ6-2]
GeneIDi401251.
KEGGihsa:401251.
UCSCiuc003nwz.4. human. [Q5SSQ6-2]

Organism-specific databases

CTDi401251.
GeneCardsiGC06P031765.
GC06Pi31741.
GC06Pj31717.
GC06Pk31712.
GC06Pm31806.
GC06Po31720.
HGNCiHGNC:13938. SAPCD1.
neXtProtiNX_Q5SSQ6.
PharmGKBiPA134974558.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG75708.
GeneTreeiENSGT00500000045192.
ENSGT00550000074977.
HOGENOMiHOG000231231.
HOVERGENiHBG057982.
InParanoidiQ5SSQ6.
OMAiLEHGQAW.
PhylomeDBiQ5SSQ6.
TreeFamiTF324086.

Miscellaneous databases

GenomeRNAii401251.
NextBioi106660.
PROiQ5SSQ6.

Gene expression databases

BgeeiQ5SSQ6.
CleanExiHS_C6orf26.
ExpressionAtlasiQ5SSQ6. baseline.
GenevisibleiQ5SSQ6. HS.

Family and domain databases

InterProiIPR026831. APC_dom.
IPR026828. Suppressor_APCD_1/2.
[Graphical view]
PANTHERiPTHR14907. PTHR14907. 1 hit.
PfamiPF11414. Suppressor_APC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse."
    Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L.
    Genome Res. 13:2621-2636(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region."
    Shiina S., Tamiya G., Oka A., Inoko H.
    Submitted (DEC-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

Entry informationi

Entry nameiSAPC1_HUMAN
AccessioniPrimary (citable) accession number: Q5SSQ6
Secondary accession number(s): A2ABF2, A2ABS9, Q9Y335
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: July 22, 2015
This is version 79 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.