Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5SSQ6 (SAPC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 70. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Suppressor APC domain-containing protein 1
Alternative name(s):
Protein G7d
Gene names
Name:SAPCD1
Synonyms:C6orf26, G7D, NG23
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length148 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence caution

The sequence CAI18428.2 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAM24986.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAM26109.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5SSQ6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5SSQ6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: K → KFSPSPLNKASSCTTQDSKERRREQNLWQQQ

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 148148Suppressor APC domain-containing protein 1
PRO_0000244082

Natural variations

Alternative sequence1171K → KFSPSPLNKASSCTTQDSKE RRREQNLWQQQ in isoform 2.
VSP_040223
Natural variant301P → S.
Corresponds to variant rs17201151 [ dbSNP | Ensembl ].
VAR_056889
Natural variant991P → L.
Corresponds to variant rs6905572 [ dbSNP | Ensembl ].
VAR_056890

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 27, 2006. Version 2.
Checksum: 6311AF525675DDFF

FASTA14816,650
        10         20         30         40         50         60 
MGSQGSGGVP LVQAPYTVLL LPLGTSRQDP GAQSFFLWLR RMQALEREQD ALWQGLELLQ 

        70         80         90        100        110        120 
HGQAWFEDHL REAQRQQLHL GALGENFLTD LHSEPGRPPL AQIQKVNICL QNLIHEKELS 

       130        140 
RQQKGVTQPK EEMAQRGCTK GPRGPTRV 

« Hide

Isoform 2 [UniParc].

Checksum: 32A02509CC44E793
Show »

FASTA17820,183

References

[1]"Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse."
Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L.
Genome Res. 13:2621-2636(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]"Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region."
Shiina S., Tamiya G., Oka A., Inoko H.
Submitted (DEC-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF134726 Genomic DNA. Translation: AAD21821.1.
BA000025 Genomic DNA. Translation: BAB63305.1.
AL662834 Genomic DNA. Translation: CAI17728.1.
AL662834 Genomic DNA. Translation: CAM24986.1. Sequence problems.
AL662899 Genomic DNA. Translation: CAI18428.2. Sequence problems.
AL662899 Genomic DNA. Translation: CAM25673.1.
BX248133 Genomic DNA. Translation: CAM26109.1. Sequence problems.
BX248133 Genomic DNA. Translation: CAM26110.1.
CR759787 Genomic DNA. Translation: CAQ10123.1.
CR759915 Genomic DNA. Translation: CAQ07250.1.
CR925765 Genomic DNA. Translation: CAQ10617.1.
BC137541 mRNA. Translation: AAI37542.1.
BC137542 mRNA. Translation: AAI37543.1.
RefSeqNP_001034740.1. NM_001039651.1.
UniGeneHs.371225.

3D structure databases

ProteinModelPortalQ5SSQ6.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid134996. 1 interaction.
STRING9606.ENSP00000403346.

Polymorphism databases

DMDM109829408.

Proteomic databases

PaxDbQ5SSQ6.
PRIDEQ5SSQ6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000415669; ENSP00000411948; ENSG00000228727. [Q5SSQ6-2]
ENST00000425424; ENSP00000413372; ENSG00000228727. [Q5SSQ6-1]
ENST00000443153; ENSP00000403687; ENSG00000227074. [Q5SSQ6-2]
ENST00000447852; ENSP00000403346; ENSG00000227861. [Q5SSQ6-2]
ENST00000449857; ENSP00000387942; ENSG00000237918. [Q5SSQ6-2]
ENST00000453534; ENSP00000404105; ENSG00000234951. [Q5SSQ6-2]
ENST00000457185; ENSP00000405513; ENSG00000229176. [Q5SSQ6-2]
ENST00000547662; ENSP00000447344; ENSG00000229176. [Q5SSQ6-1]
ENST00000548003; ENSP00000450332; ENSG00000237918. [Q5SSQ6-1]
ENST00000548987; ENSP00000448208; ENSG00000227074. [Q5SSQ6-1]
ENST00000551778; ENSP00000450257; ENSG00000234951. [Q5SSQ6-1]
ENST00000552302; ENSP00000446749; ENSG00000227861. [Q5SSQ6-1]
GeneID401251.
KEGGhsa:401251.
UCSCuc003nwz.4. human. [Q5SSQ6-2]

Organism-specific databases

CTD401251.
GeneCardsGC06P031748.
GC06Pi31741.
GC06Pj31717.
GC06Pk31712.
GC06Pm31806.
GC06Po31720.
HGNCHGNC:13938. SAPCD1.
neXtProtNX_Q5SSQ6.
PharmGKBPA134974558.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG75708.
HOGENOMHOG000231231.
HOVERGENHBG057982.
OMALEHGQAW.
PhylomeDBQ5SSQ6.
TreeFamTF324086.

Gene expression databases

BgeeQ5SSQ6.
CleanExHS_C6orf26.
GenevestigatorQ5SSQ6.

Family and domain databases

InterProIPR026831. APC_dom.
IPR026828. Suppressor_APCD_1/2.
[Graphical view]
PANTHERPTHR14907. PTHR14907. 1 hit.
PfamPF11414. Suppressor_APC. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi401251.
NextBio106660.
PROQ5SSQ6.

Entry information

Entry nameSAPC1_HUMAN
AccessionPrimary (citable) accession number: Q5SSQ6
Secondary accession number(s): A2ABF2, A2ABS9, Q9Y335
Entry history
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: April 16, 2014
This is version 70 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM