Q5SSL4 (ABR_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 67.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Active breakpoint cluster region-related protein | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 859 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | GTPase-activating protein for RAC and CDC42. Promotes the exchange of RAC or CDC42-bound GDP by GTP, thereby activating them By similarity. |
| Sequence similarities | Contains 1 C2 domain. Contains 1 DH (DBL-homology) domain. Contains 1 PH domain. Contains 1 Rho-GAP domain. |
| Sequence caution | The sequence CAI24542.3 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAQ11499.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5SSL4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5SSL4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-21: MEPLSHRGLPRLSWIDTLYSN → MAAGGRRRRPLRYQSLAALVEDSQWPFLFLVSD | ||||||
| Isoform 3 (identifier: Q5SSL4-3) The sequence of this isoform differs from the canonical sequence as follows: 1-218: Missing. 219-233: GPKDSKDSHTSVTME → MEILLIIRFCCNCTY | ||||||
| Isoform 4 (identifier: Q5SSL4-4) The sequence of this isoform differs from the canonical sequence as follows: 1-82: MEPLSHRGLP...PTPPEGLAPG → MEEEEEAIGF...SGSPFLVAVK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 859 | 859 | Active breakpoint cluster region-related protein | PRO_0000355539 | |||||
Regions | |||||||||
| Domain | 91 – 284 | 194 | DH | ||||||
| Domain | 301 – 459 | 159 | PH | ||||||
| Domain | 491 – 595 | 105 | C2 | ||||||
| Domain | 647 – 845 | 199 | Rho-GAP | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 218 | 218 | Missing in isoform 3. | VSP_035903 | |||||
| Alternative sequence | 1 – 82 | 82 | MEPLS…GLAPG → MEEEEEAIGFLDKVLEDEDV FLLEECELGTPTSPGSGSPF LVAVK in isoform 4. | VSP_035904 | |||||
| Alternative sequence | 1 – 21 | 21 | MEPLS…TLYSN → MAAGGRRRRPLRYQSLAALV EDSQWPFLFLVSD in isoform 2. | VSP_035905 | |||||
| Alternative sequence | 219 – 233 | 15 | GPKDS…SVTME → MEILLIIRFCCNCTY in isoform 3. | VSP_035906 | |||||
Experimental info | |||||||||
| Sequence conflict | 164 | 1 | W → R in BAE32119. Ref.1 | ||||||
| Sequence conflict | 630 | 1 | D → E in BAE22375. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK134993 mRNA. Translation: BAE22375.1. AK142364 mRNA. Translation: BAE25044.1. AK153615 mRNA. Translation: BAE32119.1. AL591143, AL663050 Genomic DNA. Translation: CAI24541.2. AL591143, AL663050 Genomic DNA. Translation: CAI24542.3. Sequence problems. AL591143, AL663050 Genomic DNA. Translation: CAI24543.2. AL591143, AL663050 Genomic DNA. Translation: CAI24545.1. AL591143 Genomic DNA. Translation: CAI24547.2. AL663050, AL591143 Genomic DNA. Translation: CAI25860.1. AL663050, AL591143 Genomic DNA. Translation: CAQ11498.1. AL663050, AL591143 Genomic DNA. Translation: CAQ11499.1. Sequence problems. AL663050, AL591143 Genomic DNA. Translation: CAQ11500.1. BC056385 mRNA. Translation: AAH56385.1. BC058708 mRNA. Translation: AAH58708.1. BC059064 mRNA. Translation: AAH59064.1. |
| IPI | IPI00381365. IPI00395178. IPI00515365. IPI00761596. |
| RefSeq | NP_932135.1. NM_198018.1. NP_942597.1. NM_198894.1. NP_942598.1. NM_198895.1. |
| UniGene | Mm.258939. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1XA6 based on UniProtKB P52757. |
| ProteinModelPortal | Q5SSL4. |
| SMR | Q5SSL4. Positions 504-600, 640-846. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5SSL4. 1 interaction. |
| STRING | Q5SSL4. |
PTM databases | |
| PhosphoSite | Q5SSL4. |
Proteomic databases | |
| PRIDE | Q5SSL4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000065028; ENSMUSP00000068982; ENSMUSG00000017631. ENSMUST00000072740; ENSMUSP00000072522; ENSMUSG00000017631. ENSMUST00000094012; ENSMUSP00000091551; ENSMUSG00000017631. ENSMUST00000108408; ENSMUSP00000104045; ENSMUSG00000017631. ENSMUST00000119983; ENSMUSP00000113893; ENSMUSG00000017631. ENSMUST00000155035; ENSMUSP00000122614; ENSMUSG00000017631. |
| GeneID | 109934. |
| KEGG | mmu:109934. |
| UCSC | uc007kfr.1. mouse. uc007kfs.1. mouse. uc007kft.1. mouse. uc007kfv.1. mouse. |
Organism-specific databases | |
| CTD | 29. |
| MGI | MGI:107771. Abr. |
Phylogenomic databases | |
| eggNOG | roNOG15048. |
| GeneTree | ENSGT00600000084231. |
| HOVERGEN | HBG004165. |
| OMA | AEGHEEQ. |
| OrthoDB | EOG476JZJ. |
| PhylomeDB | Q5SSL4. |
Gene expression databases | |
| ArrayExpress | Q5SSL4. |
| Bgee | Q5SSL4. |
| Genevestigator | Q5SSL4. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR000219. DH-domain. IPR001331. GDS_CDC24_CS. IPR011993. PH_type. IPR001849. Pleckstrin_homology. IPR008936. Rho_GTPase_activation_prot. IPR000198. RhoGAP_dom. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 2 hits. G3DSA:1.10.555.10. RhoGAP. 1 hit. G3DSA:1.20.900.10. RhoGEF. 1 hit. |
| Pfam | PF00168. C2. 1 hit. PF00169. PH. 1 hit. PF00620. RhoGAP. 1 hit. PF00621. RhoGEF. 1 hit. [Graphical view] |
| SMART | SM00239. C2. 1 hit. SM00233. PH. 1 hit. SM00324. RhoGAP. 1 hit. SM00325. RhoGEF. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF48065. DH-domain. 1 hit. SSF48350. Rho_GAP. 1 hit. |
| PROSITE | PS50004. C2. 1 hit. PS00741. DH_1. 1 hit. PS50010. DH_2. 1 hit. PS50003. PH_DOMAIN. 1 hit. PS50238. RHOGAP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 363025. |
| SOURCE | Search... |
Entry information
| Entry name | ABR_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q5SSL4 Secondary accession number(s): Q3U5G0 Q6PDH3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with