Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Active breakpoint cluster region-related protein

Gene

Abr

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GTPase-activating protein for RAC and CDC42. Promotes the exchange of RAC or CDC42-bound GDP by GTP, thereby activating them (By similarity).By similarity

GO - Molecular functioni

  • GTPase activator activity Source: MGI
  • Rho guanyl-nucleotide exchange factor activity Source: InterPro

GO - Biological processi

  • actin cytoskeleton organization Source: MGI
  • brain development Source: MGI
  • inner ear morphogenesis Source: MGI
  • intracellular signal transduction Source: InterPro
  • negative regulation of blood vessel remodeling Source: CACAO
  • negative regulation of cell migration Source: MGI
  • negative regulation of cellular extravasation Source: CACAO
  • negative regulation of inflammatory response Source: MGI
  • negative regulation of neutrophil degranulation Source: MGI
  • neuromuscular process controlling balance Source: MGI
  • positive regulation of GTPase activity Source: GOC
  • positive regulation of phagocytosis Source: MGI
  • regulation of Rho protein signal transduction Source: InterPro
  • regulation of vascular permeability Source: CACAO
  • response to lipopolysaccharide Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation, Guanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-MMU-193648. NRAGE signals death through JNK.
R-MMU-194840. Rho GTPase cycle.
R-MMU-416482. G alpha (12/13) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Active breakpoint cluster region-related protein
Gene namesi
Name:Abr
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:107771. Abr.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: MGI
  • membrane Source: MGI
  • plasma membrane Source: MGI
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 859859Active breakpoint cluster region-related proteinPRO_0000355539Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei57 – 571PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ5SSL4.
MaxQBiQ5SSL4.
PaxDbiQ5SSL4.
PRIDEiQ5SSL4.

PTM databases

iPTMnetiQ5SSL4.
PhosphoSiteiQ5SSL4.

Expressioni

Gene expression databases

BgeeiQ5SSL4.
ExpressionAtlasiQ5SSL4. baseline and differential.
GenevisibleiQ5SSL4. MM.

Interactioni

Protein-protein interaction databases

BioGridi225161. 1 interaction.
IntActiQ5SSL4. 2 interactions.
STRINGi10090.ENSMUSP00000091551.

Structurei

3D structure databases

ProteinModelPortaliQ5SSL4.
SMRiQ5SSL4. Positions 76-414, 502-600, 660-841.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini91 – 284194DHPROSITE-ProRule annotationAdd
BLAST
Domaini301 – 459159PHPROSITE-ProRule annotationAdd
BLAST
Domaini491 – 595105C2PROSITE-ProRule annotationAdd
BLAST
Domaini647 – 845199Rho-GAPPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG4269. Eukaryota.
ENOG410XPGZ. LUCA.
GeneTreeiENSGT00840000129703.
HOVERGENiHBG004165.
InParanoidiQ5SSL4.
OMAiWPFLFLV.
OrthoDBiEOG7BP81P.
PhylomeDBiQ5SSL4.
TreeFamiTF105082.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
1.20.900.10. 1 hit.
2.30.29.30. 2 hits.
2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
IPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00168. C2. 1 hit.
PF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 1 hit.
SM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF48350. SSF48350. 1 hit.
SSF49562. SSF49562. 1 hit.
SSF50729. SSF50729. 2 hits.
PROSITEiPS50004. C2. 1 hit.
PS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5SSL4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPLSHRGLP RLSWIDTLYS NFSYGAEDYD AEGHEEQKGP PEGSETMPYI
60 70 80 90 100
DESPTMSPQL SARSQGGGDS VSPTPPEGLA PGVEAGKGLE MRKLVLSGFL
110 120 130 140 150
ASEEIYINQL EALLLPMKPL KATATTSQPV LTIQQIETIF YKIQDIYEIH
160 170 180 190 200
KEFYDNLCPK VQQWDSQVTM GHLFQKLASQ LGVYKAFVDN YKVALETAEK
210 220 230 240 250
CSQSNNQFQK ISEELKVKGP KDSKDSHTSV TMEALLYKPI DRVTRSTLVL
260 270 280 290 300
HDLLKHTPVD HPDYPLLQDA LRISQNFLSS INEDIDPRRT AVTTPKGETR
310 320 330 340 350
QLVKDGFLVE MSESSRKLRH VFLFTDVLLC AKLKKTSAGK HQQYDCKWYI
360 370 380 390 400
PLADLVFPSP EESEASPQVH PFPDHELEDM KTKISALKSE IQKEKANKGQ
410 420 430 440 450
SRAIERLKKK MFENEFLLLL NSPTIPFRIH NRNGKSYLFL LSSDYERSEW
460 470 480 490 500
REAIQKLQKK DLQAFVLSSV ELQVLTGSCF KLRTVHNIPV TSNKDDDESP
510 520 530 540 550
GLYGFLHVIV HSAKGFKQSA NLYCTLEVDS FGYFVSKAKT RVFRDTTEPK
560 570 580 590 600
WDEEFEIELE GSQSLRILCY EKCYDKTKVN KDNNEIVDKI MGKGQIQLDP
610 620 630 640 650
QTVESKNWHT DVIEMNGIKV EFSMKFTSRD MSLKRTPSKK QTGVFGVKIS
660 670 680 690 700
VVTKRERSKV PYIVRQCIEE VEKRGIEEVG IYRISGVATD IQALKAVFDA
710 720 730 740 750
NNKDILLMLS DMDINAIAGT LKLYFRELPE PLLTDRLYPA FMEGIALSDP
760 770 780 790 800
AAKENCMMHL LRSLPDPNLI TFLFLLEHLK RVAEKEPINK MSLHNLATVF
810 820 830 840 850
GPTLLRPSEV ESKAHLTSAA DIWSHDVMAQ VQVLLYYLQH PPISFAELKR

NTLYFSTDV
Length:859
Mass (Da):97,667
Last modified:December 21, 2004 - v1
Checksum:i79ED2F432899A1F9
GO
Isoform 2 (identifier: Q5SSL4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MEPLSHRGLPRLSWIDTLYSN → MAAGGRRRRPLRYQSLAALVEDSQWPFLFLVSD

Show »
Length:871
Mass (Da):98,988
Checksum:iF55B406BB440733F
GO
Isoform 3 (identifier: Q5SSL4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-218: Missing.
     219-233: GPKDSKDSHTSVTME → MEILLIIRFCCNCTY

Show »
Length:641
Mass (Da):73,549
Checksum:iCACCE137EDA9D9F7
GO
Isoform 4 (identifier: Q5SSL4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: MEPLSHRGLP...PTPPEGLAPG → MEEEEEAIGF...SGSPFLVAVK

Show »
Length:822
Mass (Da):93,773
Checksum:i10529465B3E4920A
GO

Sequence cautioni

The sequence CAI24542.3 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAQ11499.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti164 – 1641W → R in BAE32119 (PubMed:16141072).Curated
Sequence conflicti630 – 6301D → E in BAE22375 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 218218Missing in isoform 3. 2 PublicationsVSP_035903Add
BLAST
Alternative sequencei1 – 8282MEPLS…GLAPG → MEEEEEAIGFLDKVLEDEDV FLLEECELGTPTSPGSGSPF LVAVK in isoform 4. 1 PublicationVSP_035904Add
BLAST
Alternative sequencei1 – 2121MEPLS…TLYSN → MAAGGRRRRPLRYQSLAALV EDSQWPFLFLVSD in isoform 2. 1 PublicationVSP_035905Add
BLAST
Alternative sequencei219 – 23315GPKDS…SVTME → MEILLIIRFCCNCTY in isoform 3. 2 PublicationsVSP_035906Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK134993 mRNA. Translation: BAE22375.1.
AK142364 mRNA. Translation: BAE25044.1.
AK153615 mRNA. Translation: BAE32119.1.
AL591143, AL663050 Genomic DNA. Translation: CAI24541.2.
AL591143, AL663050 Genomic DNA. Translation: CAI24542.3. Sequence problems.
AL591143, AL663050 Genomic DNA. Translation: CAI24543.2.
AL591143, AL663050 Genomic DNA. Translation: CAI24545.1.
AL591143 Genomic DNA. Translation: CAI24547.2.
AL663050, AL591143 Genomic DNA. Translation: CAI25860.1.
AL663050, AL591143 Genomic DNA. Translation: CAQ11498.1.
AL663050, AL591143 Genomic DNA. Translation: CAQ11499.1. Sequence problems.
AL663050, AL591143 Genomic DNA. Translation: CAQ11500.1.
BC056385 mRNA. Translation: AAH56385.1.
BC058708 mRNA. Translation: AAH58708.1.
BC059064 mRNA. Translation: AAH59064.1.
CCDSiCCDS25066.1. [Q5SSL4-1]
CCDS36231.1. [Q5SSL4-2]
CCDS70246.1. [Q5SSL4-3]
RefSeqiNP_001278115.1. NM_001291186.1. [Q5SSL4-3]
NP_932135.1. NM_198018.2. [Q5SSL4-2]
NP_942597.1. NM_198894.2.
NP_942598.1. NM_198895.2. [Q5SSL4-1]
XP_006532045.1. XM_006531982.2. [Q5SSL4-4]
UniGeneiMm.258939.

Genome annotation databases

EnsembliENSMUST00000065028; ENSMUSP00000068982; ENSMUSG00000017631. [Q5SSL4-3]
ENSMUST00000072740; ENSMUSP00000072522; ENSMUSG00000017631. [Q5SSL4-1]
ENSMUST00000094012; ENSMUSP00000091551; ENSMUSG00000017631. [Q5SSL4-2]
ENSMUST00000108408; ENSMUSP00000104045; ENSMUSG00000017631. [Q5SSL4-4]
GeneIDi109934.
KEGGimmu:109934.
UCSCiuc007kfr.2. mouse. [Q5SSL4-3]
uc007kfs.2. mouse. [Q5SSL4-2]
uc007kft.2. mouse. [Q5SSL4-1]
uc007kfv.1. mouse. [Q5SSL4-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK134993 mRNA. Translation: BAE22375.1.
AK142364 mRNA. Translation: BAE25044.1.
AK153615 mRNA. Translation: BAE32119.1.
AL591143, AL663050 Genomic DNA. Translation: CAI24541.2.
AL591143, AL663050 Genomic DNA. Translation: CAI24542.3. Sequence problems.
AL591143, AL663050 Genomic DNA. Translation: CAI24543.2.
AL591143, AL663050 Genomic DNA. Translation: CAI24545.1.
AL591143 Genomic DNA. Translation: CAI24547.2.
AL663050, AL591143 Genomic DNA. Translation: CAI25860.1.
AL663050, AL591143 Genomic DNA. Translation: CAQ11498.1.
AL663050, AL591143 Genomic DNA. Translation: CAQ11499.1. Sequence problems.
AL663050, AL591143 Genomic DNA. Translation: CAQ11500.1.
BC056385 mRNA. Translation: AAH56385.1.
BC058708 mRNA. Translation: AAH58708.1.
BC059064 mRNA. Translation: AAH59064.1.
CCDSiCCDS25066.1. [Q5SSL4-1]
CCDS36231.1. [Q5SSL4-2]
CCDS70246.1. [Q5SSL4-3]
RefSeqiNP_001278115.1. NM_001291186.1. [Q5SSL4-3]
NP_932135.1. NM_198018.2. [Q5SSL4-2]
NP_942597.1. NM_198894.2.
NP_942598.1. NM_198895.2. [Q5SSL4-1]
XP_006532045.1. XM_006531982.2. [Q5SSL4-4]
UniGeneiMm.258939.

3D structure databases

ProteinModelPortaliQ5SSL4.
SMRiQ5SSL4. Positions 76-414, 502-600, 660-841.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi225161. 1 interaction.
IntActiQ5SSL4. 2 interactions.
STRINGi10090.ENSMUSP00000091551.

PTM databases

iPTMnetiQ5SSL4.
PhosphoSiteiQ5SSL4.

Proteomic databases

EPDiQ5SSL4.
MaxQBiQ5SSL4.
PaxDbiQ5SSL4.
PRIDEiQ5SSL4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000065028; ENSMUSP00000068982; ENSMUSG00000017631. [Q5SSL4-3]
ENSMUST00000072740; ENSMUSP00000072522; ENSMUSG00000017631. [Q5SSL4-1]
ENSMUST00000094012; ENSMUSP00000091551; ENSMUSG00000017631. [Q5SSL4-2]
ENSMUST00000108408; ENSMUSP00000104045; ENSMUSG00000017631. [Q5SSL4-4]
GeneIDi109934.
KEGGimmu:109934.
UCSCiuc007kfr.2. mouse. [Q5SSL4-3]
uc007kfs.2. mouse. [Q5SSL4-2]
uc007kft.2. mouse. [Q5SSL4-1]
uc007kfv.1. mouse. [Q5SSL4-4]

Organism-specific databases

CTDi29.
MGIiMGI:107771. Abr.

Phylogenomic databases

eggNOGiKOG4269. Eukaryota.
ENOG410XPGZ. LUCA.
GeneTreeiENSGT00840000129703.
HOVERGENiHBG004165.
InParanoidiQ5SSL4.
OMAiWPFLFLV.
OrthoDBiEOG7BP81P.
PhylomeDBiQ5SSL4.
TreeFamiTF105082.

Enzyme and pathway databases

ReactomeiR-MMU-193648. NRAGE signals death through JNK.
R-MMU-194840. Rho GTPase cycle.
R-MMU-416482. G alpha (12/13) signalling events.

Miscellaneous databases

ChiTaRSiAbr. mouse.
NextBioi363025.
PROiQ5SSL4.
SOURCEiSearch...

Gene expression databases

BgeeiQ5SSL4.
ExpressionAtlasiQ5SSL4. baseline and differential.
GenevisibleiQ5SSL4. MM.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
1.20.900.10. 1 hit.
2.30.29.30. 2 hits.
2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
IPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00168. C2. 1 hit.
PF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 1 hit.
SM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF48350. SSF48350. 1 hit.
SSF49562. SSF49562. 1 hit.
SSF50729. SSF50729. 2 hits.
PROSITEiPS50004. C2. 1 hit.
PS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-407 (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Lung, Olfactory bulb and Thymus.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6J.
    Tissue: Brain.
  4. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-57, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Lung and Spleen.

Entry informationi

Entry nameiABR_MOUSE
AccessioniPrimary (citable) accession number: Q5SSL4
Secondary accession number(s): Q3U5G0
, Q3UQJ6, Q3UY38, Q5SYJ5, Q5SYJ7, Q5SYJ8, Q5SYJ9, Q6PCY1, Q6PDH3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 25, 2008
Last sequence update: December 21, 2004
Last modified: May 11, 2016
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.