Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C6orf10

Gene

C6orf10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C6orf10
Gene namesi
Name:C6orf10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000204296.11.
HGNCiHGNC:13922. C6orf10.
neXtProtiNX_Q5SRN2.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei3 – 23HelicalSequence analysisAdd BLAST21
Transmembranei99 – 119HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi10665.
OpenTargetsiENSG00000204296.
PharmGKBiPA25923.

Polymorphism and mutation databases

BioMutaiC6orf10.
DMDMi317373458.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000895031 – 563Uncharacterized protein C6orf10Add BLAST563

Proteomic databases

PaxDbiQ5SRN2.
PeptideAtlasiQ5SRN2.
PRIDEiQ5SRN2.

PTM databases

iPTMnetiQ5SRN2.
PhosphoSitePlusiQ5SRN2.

Expressioni

Gene expression databases

BgeeiENSG00000204296.
CleanExiHS_C6orf10.
ExpressionAtlasiQ5SRN2. baseline and differential.
GenevisibleiQ5SRN2. HS.

Interactioni

Protein-protein interaction databases

BioGridi115907. 2 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ5SRN2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi474 – 560Lys-richAdd BLAST87

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J4K6. Eukaryota.
ENOG4111AWZ. LUCA.
GeneTreeiENSGT00530000064839.
HOVERGENiHBG053844.
InParanoidiQ5SRN2.
PhylomeDBiQ5SRN2.
TreeFamiTF342352.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5SRN2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTVLEITLAV ILTLLGLAIL AILLTRWARC KQSEMYISRY SSEQSARLLD
60 70 80 90 100
YEDGRGSRHA YSTQSDTSYD NRERSKRDYT PSTNSLVSMA SKFSLGQTEL
110 120 130 140 150
ILLLMCFILA LSRSSIGSIK CLQTTEEPPS RTAGAMMQFT APIPGATGPI
160 170 180 190 200
KLSQKTIVQT PGPIVQYPGS NAGPPSAPRG PPMAPIIISQ RTARIPQVHT
210 220 230 240 250
MDSSGKITLT PVVILTGYMD EELAKKSCSK IQILKCGGTA RSQNSREENK
260 270 280 290 300
EALKNDIIFT NSVESLKSAH IKEPEREGKG TDLEKDKIGM EVKVDSDAGI
310 320 330 340 350
PKRQETQLKI SEMSIPQGQG AQIKKSVSDV PRGQESQVKK SESGVPKGQE
360 370 380 390 400
AQVTKSGLVV LKGQEAQVEK SEMGVPRRQE SQVKKSQSGV SKGQEAQVKK
410 420 430 440 450
RESVVLKGQE AQVEKSELKV PKGQEGQVEK TEADVPKEQE VQEKKSEAGV
460 470 480 490 500
LKGPESQVKN TEVSVPETLE SQVKKSESGV LKGQEAQEKK ESFEDKGNND
510 520 530 540 550
KEKERDAEKD PNKKEKGDKN TKGDKGKDKV KGKRESEING EKSKGSKRAK
560
ANTGRKYNKK VEE
Length:563
Mass (Da):61,626
Last modified:January 11, 2011 - v3
Checksum:iD5A75E4624FD2E6E
GO
Isoform 2 (identifier: Q5SRN2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-117: VSMASKFSLGQTELILLLMCFILALSRSSIG → ALSRSSIALPQGSMS
     172-172: A → VRSHPHTIT
     193-193: A → ASQLAAPI

Note: No experimental confirmation available.
Show »
Length:562
Mass (Da):61,440
Checksum:iFACF12187A203A88
GO
Isoform 3 (identifier: Q5SRN2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-117: VSMASKFSLGQTELILLLMCFILALSRSSIG → ALSRSSIALPQGSMS
     193-193: A → ASQLAAPIIISQRTA

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:561
Mass (Da):61,251
Checksum:i7C0BB8424CF779EF
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02287530C → R2 PublicationsCorresponds to variant dbSNP:rs3129941Ensembl.1
Natural variantiVAR_02287636Y → H2 PublicationsCorresponds to variant dbSNP:rs9268384Ensembl.1
Natural variantiVAR_02287769Y → C2 PublicationsCorresponds to variant dbSNP:rs9268368Ensembl.1
Natural variantiVAR_022878128P → L2 PublicationsCorresponds to variant dbSNP:rs1033500Ensembl.1
Natural variantiVAR_022879150I → F1 PublicationCorresponds to variant dbSNP:rs1265754Ensembl.1
Natural variantiVAR_033068161P → L1 PublicationCorresponds to variant dbSNP:rs1003878Ensembl.1
Natural variantiVAR_022880170S → P2 PublicationsCorresponds to variant dbSNP:rs9405090Ensembl.1
Natural variantiVAR_022881227S → P2 PublicationsCorresponds to variant dbSNP:rs560505Ensembl.1
Natural variantiVAR_056793266L → W. Corresponds to variant dbSNP:rs4947338Ensembl.1
Natural variantiVAR_056794274P → S. Corresponds to variant dbSNP:rs34498363Ensembl.1
Natural variantiVAR_022882315I → V1 PublicationCorresponds to variant dbSNP:rs3749966Ensembl.1
Natural variantiVAR_022883400K → Q1 PublicationCorresponds to variant dbSNP:rs7775397Ensembl.1
Natural variantiVAR_056795433A → T. Corresponds to variant dbSNP:rs16870005Ensembl.1
Natural variantiVAR_056796479G → V. Corresponds to variant dbSNP:rs7751028Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01464587 – 117VSMAS…RSSIG → ALSRSSIALPQGSMS in isoform 2 and isoform 3. CuratedAdd BLAST31
Alternative sequenceiVSP_014646172A → VRSHPHTIT in isoform 2. Curated1
Alternative sequenceiVSP_014647193A → ASQLAAPI in isoform 2. Curated1
Alternative sequenceiVSP_055702193A → ASQLAAPIIISQRTA in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL034394, AL035445 Genomic DNA. Translation: CAI42178.1.
AL034394, AL035445 Genomic DNA. Translation: CAI42179.1.
AL035445, AL034394 Genomic DNA. Translation: CAI20345.1.
AL035445, AL034394 Genomic DNA. Translation: CAI20346.1.
AL662796 Genomic DNA. No translation available.
AL670296, AL845557 Genomic DNA. Translation: CAI17567.2.
AL670296, AL845557 Genomic DNA. Translation: CAI17568.2.
AL671511 Genomic DNA. No translation available.
AL845509, BX001039 Genomic DNA. Translation: CAI18565.1.
AL845509, BX001039 Genomic DNA. Translation: CAI18566.1.
AL845557, AL670296 Genomic DNA. Translation: CAI17766.1.
AL845557, AL670296 Genomic DNA. Translation: CAI17767.1.
BX001039, AL845509 Genomic DNA. Translation: CAI18571.1.
BX001039, AL845509 Genomic DNA. Translation: CAI18572.1.
BX119999, BX255945, BX284927 Genomic DNA. Translation: CAM26199.1.
BX119999, BX255945, BX284927 Genomic DNA. Translation: CAM26200.1.
BX255945, BX284927, BX119999 Genomic DNA. Translation: CAM26169.1.
BX255945, BX284927, BX119999 Genomic DNA. Translation: CAM26170.1.
BX284927, BX119999, BX255945 Genomic DNA. Translation: CAM25851.1.
BX284927, BX255945, BX119999 Genomic DNA. Translation: CAM25852.1.
BX908732, BX927180 Genomic DNA. Translation: CAQ07324.1.
BX927180, BX908732 Genomic DNA. Translation: CAQ08441.1.
BX908732, BX927180 Genomic DNA. Translation: CAQ07323.1.
BX927180, BX908732 Genomic DNA. Translation: CAQ08440.1.
BC034774 mRNA. Translation: AAH34774.1.
CCDSiCCDS34422.1. [Q5SRN2-1]
CCDS69082.1. [Q5SRN2-3]
RefSeqiNP_001273403.1. NM_001286474.1. [Q5SRN2-3]
NP_001273404.1. NM_001286475.1.
NP_006772.3. NM_006781.4. [Q5SRN2-1]
UniGeneiHs.567414.

Genome annotation databases

EnsembliENST00000375015; ENSP00000364155; ENSG00000204296. [Q5SRN2-2]
ENST00000383130; ENSP00000372611; ENSG00000206245. [Q5SRN2-1]
ENST00000399749; ENSP00000382654; ENSG00000206310.
ENST00000447241; ENSP00000415517; ENSG00000204296. [Q5SRN2-1]
ENST00000448986; ENSP00000410514; ENSG00000206245. [Q5SRN2-2]
ENST00000457429; ENSP00000408514; ENSG00000232106.
ENST00000533191; ENSP00000431199; ENSG00000204296. [Q5SRN2-3]
ENST00000548927; ENSP00000448472; ENSG00000206245. [Q5SRN2-3]
ENST00000612031; ENSP00000480403; ENSG00000204296. [Q5SRN2-1]
ENST00000618584; ENSP00000485011; ENSG00000206245. [Q5SRN2-1]
GeneIDi10665.
KEGGihsa:10665.
UCSCiuc011jsa.4. human. [Q5SRN2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCF010_HUMAN
AccessioniPrimary (citable) accession number: Q5SRN2
Secondary accession number(s): A2BET1
, A2BET2, A6NME2, B0S7R2, B0S7R3, E9PMB1, Q5SPI9, Q5SPJ0, Q5SPK9, Q5SPL0, Q5SRN3, Q5TG25, Q5TG26, Q8N4B6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: January 11, 2011
Last modified: February 28, 2018
This is version 107 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome