Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5SR56

- HIAL1_HUMAN

UniProt

Q5SR56 - HIAL1_HUMAN

Protein

Hippocampus abundant transcript-like protein 1

Gene

HIATL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 86 (01 Oct 2014)
      Sequence version 3 (26 May 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. transporter activity Source: InterPro

    GO - Biological processi

    1. transmembrane transport Source: InterPro

    Keywords - Biological processi

    Transport

    Protein family/group databases

    TCDBi2.A.1.2.30. the major facilitator superfamily (mfs).

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Hippocampus abundant transcript-like protein 1
    Gene namesi
    Name:HIATL1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:23376. HIATL1.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: InterPro

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142671691.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 506506Hippocampus abundant transcript-like protein 1PRO_0000239229Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi463 – 4631N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ5SR56.
    PaxDbiQ5SR56.
    PRIDEiQ5SR56.

    PTM databases

    PhosphoSiteiQ5SR56.

    Expressioni

    Gene expression databases

    ArrayExpressiQ5SR56.
    BgeeiQ5SR56.
    CleanExiHS_HIATL1.
    GenevestigatoriQ5SR56.

    Organism-specific databases

    HPAiHPA017978.

    Interactioni

    Protein-protein interaction databases

    BioGridi124166. 2 interactions.
    IntActiQ5SR56. 1 interaction.
    STRINGi9606.ENSP00000364493.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5SR56.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 4949ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini71 – 8212CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini104 – 1118ExtracellularSequence Analysis
    Topological domaini133 – 1342CytoplasmicSequence Analysis
    Topological domaini156 – 16813ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini190 – 1967CytoplasmicSequence Analysis
    Topological domaini218 – 25538ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini277 – 2815CytoplasmicSequence Analysis
    Topological domaini303 – 31917ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini341 – 3411CytoplasmicSequence Analysis
    Topological domaini363 – 38725ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini409 – 42820CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini450 – 50657ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei50 – 7021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei83 – 10321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei112 – 13221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei135 – 15521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei169 – 18921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei197 – 21721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei256 – 27621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei282 – 30221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei320 – 34021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei342 – 36221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei388 – 40821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei429 – 44921HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the major facilitator superfamily.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0477.
    HOGENOMiHOG000007094.
    HOVERGENiHBG051902.
    InParanoidiQ5SR56.
    OMAiVSWGAQI.
    OrthoDBiEOG712TW3.
    PhylomeDBiQ5SR56.
    TreeFamiTF313511.

    Family and domain databases

    InterProiIPR011701. MFS.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    IPR005829. Sugar_transporter_CS.
    IPR001958. Tet-R_TetA/multi-R_MdtG.
    [Graphical view]
    PfamiPF07690. MFS_1. 1 hit.
    [Graphical view]
    PRINTSiPR01035. TCRTETA.
    SUPFAMiSSF103473. SSF103473. 1 hit.
    PROSITEiPS50850. MFS. 1 hit.
    PS00216. SUGAR_TRANSPORT_1. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5SR56-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSVEPPPELE EKAASEPEAG AMPEKRAGAQ AAGSTWLQGF GRPSVYHAAI    50
    VIFLEFFAWG LLTTPMLTVL HETFSQHTFL MNGLIQGVKG LLSFLSAPLI 100
    GALSDVWGRK PFLLGTVFFT CFPIPLMRIS PWWYFAMISV SGVFSVTFSV 150
    IFAYVADVTQ EHERSTAYGW VSATFAASLV SSPAIGAYLS ASYGDSLVVL 200
    VATVVALLDI CFILVAVPES LPEKMRPVSW GAQISWKQAD PFASLKKVGK 250
    DSTVLLICIT VFLSYLPEAG QYSSFFLYLR QVIGFGSVKI AAFIAMVGIL 300
    SIVAQTAFLS ILMRSLGNKN TVLLGLGFQM LQLAWYGFGS QAWMMWAAGT 350
    VAAMSSITFP AISALVSRNA ESDQQGVAQG IITGIRGLCN GLGPALYGFI 400
    FYMFHVELTE LGPKLNSNNV PLQGAVIPGP PFLFGACIVL MSFLVALFIP 450
    EYSKASGVQK HSNSSSGSLT NTPERGSDED IEPLLQDSSI WELSSFEEPG 500
    NQCTEL 506
    Length:506
    Mass (Da):54,545
    Last modified:May 26, 2009 - v3
    Checksum:i4CD09B8A06EC6EA5
    GO
    Isoform 2 (identifier: Q5SR56-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-65: Missing.
         344-376: MMWAAGTVAAMSSITFPAISALVSRNAESDQQG → SCPGDHNWNKRTMQWPGASTVWLHILHVPCGTD
         377-506: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:311
    Mass (Da):34,048
    Checksum:i8E5B8B10308D4ACF
    GO

    Sequence cautioni

    The sequence AAI06063.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB55274.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAD96556.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti367 – 3671S → T in BAB55274. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti406 – 4061V → L.1 Publication
    Corresponds to variant rs17851857 [ dbSNP | Ensembl ].
    VAR_055401

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6565Missing in isoform 2. 1 PublicationVSP_056692Add
    BLAST
    Alternative sequencei344 – 37633MMWAA…SDQQG → SCPGDHNWNKRTMQWPGAST VWLHILHVPCGTD in isoform 2. 1 PublicationVSP_056693Add
    BLAST
    Alternative sequencei377 – 506130Missing in isoform 2. 1 PublicationVSP_056694Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK027659 mRNA. Translation: BAB55274.1. Different initiation.
    AK300615 mRNA. Translation: BAG62308.1.
    AL691447, AL358232 Genomic DNA. Translation: CAI13281.1.
    AL358232, AL691447 Genomic DNA. Translation: CAI15197.1.
    BC106062 mRNA. Translation: AAI06063.1. Different initiation.
    BC021093 mRNA. Translation: AAH21093.2.
    AK222836 mRNA. Translation: BAD96556.1. Different initiation.
    CCDSiCCDS6710.2.
    RefSeqiNP_115947.2. NM_032558.2.
    UniGeneiHs.555996.

    Genome annotation databases

    EnsembliENST00000375344; ENSP00000364493; ENSG00000148110.
    ENST00000428393; ENSP00000405909; ENSG00000148110.
    GeneIDi84641.
    KEGGihsa:84641.
    UCSCiuc004aur.3. human.

    Polymorphism databases

    DMDMi238054382.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK027659 mRNA. Translation: BAB55274.1 . Different initiation.
    AK300615 mRNA. Translation: BAG62308.1 .
    AL691447 , AL358232 Genomic DNA. Translation: CAI13281.1 .
    AL358232 , AL691447 Genomic DNA. Translation: CAI15197.1 .
    BC106062 mRNA. Translation: AAI06063.1 . Different initiation.
    BC021093 mRNA. Translation: AAH21093.2 .
    AK222836 mRNA. Translation: BAD96556.1 . Different initiation.
    CCDSi CCDS6710.2.
    RefSeqi NP_115947.2. NM_032558.2.
    UniGenei Hs.555996.

    3D structure databases

    ProteinModelPortali Q5SR56.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124166. 2 interactions.
    IntActi Q5SR56. 1 interaction.
    STRINGi 9606.ENSP00000364493.

    Protein family/group databases

    TCDBi 2.A.1.2.30. the major facilitator superfamily (mfs).

    PTM databases

    PhosphoSitei Q5SR56.

    Polymorphism databases

    DMDMi 238054382.

    Proteomic databases

    MaxQBi Q5SR56.
    PaxDbi Q5SR56.
    PRIDEi Q5SR56.

    Protocols and materials databases

    DNASUi 84641.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000375344 ; ENSP00000364493 ; ENSG00000148110 .
    ENST00000428393 ; ENSP00000405909 ; ENSG00000148110 .
    GeneIDi 84641.
    KEGGi hsa:84641.
    UCSCi uc004aur.3. human.

    Organism-specific databases

    CTDi 84641.
    GeneCardsi GC09P097136.
    HGNCi HGNC:23376. HIATL1.
    HPAi HPA017978.
    neXtProti NX_Q5SR56.
    PharmGKBi PA142671691.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0477.
    HOGENOMi HOG000007094.
    HOVERGENi HBG051902.
    InParanoidi Q5SR56.
    OMAi VSWGAQI.
    OrthoDBi EOG712TW3.
    PhylomeDBi Q5SR56.
    TreeFami TF313511.

    Miscellaneous databases

    ChiTaRSi HIATL1. human.
    GenomeRNAii 84641.
    NextBioi 74579.
    PROi Q5SR56.

    Gene expression databases

    ArrayExpressi Q5SR56.
    Bgeei Q5SR56.
    CleanExi HS_HIATL1.
    Genevestigatori Q5SR56.

    Family and domain databases

    InterProi IPR011701. MFS.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    IPR005829. Sugar_transporter_CS.
    IPR001958. Tet-R_TetA/multi-R_MdtG.
    [Graphical view ]
    Pfami PF07690. MFS_1. 1 hit.
    [Graphical view ]
    PRINTSi PR01035. TCRTETA.
    SUPFAMi SSF103473. SSF103473. 1 hit.
    PROSITEi PS50850. MFS. 1 hit.
    PS00216. SUGAR_TRANSPORT_1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 143-506 (ISOFORM 1).
    2. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-406.
      Tissue: Skin.
    4. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 140-506 (ISOFORM 1).
      Tissue: Liver.

    Entry informationi

    Entry nameiHIAL1_HUMAN
    AccessioniPrimary (citable) accession number: Q5SR56
    Secondary accession number(s): B4DUE6
    , E9PD58, Q3KQT4, Q53GU5, Q8WU95, Q96SM4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 13, 2006
    Last sequence update: May 26, 2009
    Last modified: October 1, 2014
    This is version 86 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3