Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hippocampus abundant transcript-like protein 1

Gene

MFSD14B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transport

Protein family/group databases

TCDBi2.A.1.2.30. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Hippocampus abundant transcript-like protein 1Imported
Alternative name(s):
Major facilitator superfamily domain-containing 14BImported
Gene namesi
Name:MFSD14BImported
Synonyms:HIATL1Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:23376. MFSD14B.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 49ExtracellularSequence analysisAdd BLAST49
Transmembranei50 – 70HelicalSequence analysisAdd BLAST21
Topological domaini71 – 82CytoplasmicSequence analysisAdd BLAST12
Transmembranei83 – 103HelicalSequence analysisAdd BLAST21
Topological domaini104 – 111ExtracellularSequence analysis8
Transmembranei112 – 132HelicalSequence analysisAdd BLAST21
Topological domaini133 – 134CytoplasmicSequence analysis2
Transmembranei135 – 155HelicalSequence analysisAdd BLAST21
Topological domaini156 – 168ExtracellularSequence analysisAdd BLAST13
Transmembranei169 – 189HelicalSequence analysisAdd BLAST21
Topological domaini190 – 196CytoplasmicSequence analysis7
Transmembranei197 – 217HelicalSequence analysisAdd BLAST21
Topological domaini218 – 255ExtracellularSequence analysisAdd BLAST38
Transmembranei256 – 276HelicalSequence analysisAdd BLAST21
Topological domaini277 – 281CytoplasmicSequence analysis5
Transmembranei282 – 302HelicalSequence analysisAdd BLAST21
Topological domaini303 – 319ExtracellularSequence analysisAdd BLAST17
Transmembranei320 – 340HelicalSequence analysisAdd BLAST21
Topological domaini341CytoplasmicSequence analysis1
Transmembranei342 – 362HelicalSequence analysisAdd BLAST21
Topological domaini363 – 387ExtracellularSequence analysisAdd BLAST25
Transmembranei388 – 408HelicalSequence analysisAdd BLAST21
Topological domaini409 – 428CytoplasmicSequence analysisAdd BLAST20
Transmembranei429 – 449HelicalSequence analysisAdd BLAST21
Topological domaini450 – 506ExtracellularSequence analysisAdd BLAST57

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000148110.
PharmGKBiPA142671691.

Polymorphism and mutation databases

BioMutaiHIATL1.
DMDMi238054382.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002392291 – 506Hippocampus abundant transcript-like protein 1Add BLAST506

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi463N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ5SR56.
MaxQBiQ5SR56.
PaxDbiQ5SR56.
PeptideAtlasiQ5SR56.
PRIDEiQ5SR56.

PTM databases

iPTMnetiQ5SR56.
PhosphoSitePlusiQ5SR56.

Expressioni

Gene expression databases

BgeeiENSG00000148110.
CleanExiHS_HIATL1.
ExpressionAtlasiQ5SR56. baseline and differential.
GenevisibleiQ5SR56. HS.

Organism-specific databases

HPAiHPA017978.

Interactioni

Protein-protein interaction databases

BioGridi124166. 2 interactors.
IntActiQ5SR56. 1 interactor.
STRINGi9606.ENSP00000364493.

Structurei

3D structure databases

ProteinModelPortaliQ5SR56.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the major facilitator superfamily.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2816. Eukaryota.
ENOG410ZVCA. LUCA.
GeneTreeiENSGT00510000046502.
HOGENOMiHOG000007094.
HOVERGENiHBG051902.
InParanoidiQ5SR56.
OMAiIKYMPES.
OrthoDBiEOG091G088Z.
PhylomeDBiQ5SR56.
TreeFamiTF313511.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR011701. MFS.
IPR020846. MFS_dom.
IPR005829. Sugar_transporter_CS.
IPR001958. Tet-R_TetA/multi-R_MdtG.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
PRINTSiPR01035. TCRTETA.
SUPFAMiSSF103473. SSF103473. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5SR56-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVEPPPELE EKAASEPEAG AMPEKRAGAQ AAGSTWLQGF GRPSVYHAAI
60 70 80 90 100
VIFLEFFAWG LLTTPMLTVL HETFSQHTFL MNGLIQGVKG LLSFLSAPLI
110 120 130 140 150
GALSDVWGRK PFLLGTVFFT CFPIPLMRIS PWWYFAMISV SGVFSVTFSV
160 170 180 190 200
IFAYVADVTQ EHERSTAYGW VSATFAASLV SSPAIGAYLS ASYGDSLVVL
210 220 230 240 250
VATVVALLDI CFILVAVPES LPEKMRPVSW GAQISWKQAD PFASLKKVGK
260 270 280 290 300
DSTVLLICIT VFLSYLPEAG QYSSFFLYLR QVIGFGSVKI AAFIAMVGIL
310 320 330 340 350
SIVAQTAFLS ILMRSLGNKN TVLLGLGFQM LQLAWYGFGS QAWMMWAAGT
360 370 380 390 400
VAAMSSITFP AISALVSRNA ESDQQGVAQG IITGIRGLCN GLGPALYGFI
410 420 430 440 450
FYMFHVELTE LGPKLNSNNV PLQGAVIPGP PFLFGACIVL MSFLVALFIP
460 470 480 490 500
EYSKASGVQK HSNSSSGSLT NTPERGSDED IEPLLQDSSI WELSSFEEPG

NQCTEL
Length:506
Mass (Da):54,545
Last modified:May 26, 2009 - v3
Checksum:i4CD09B8A06EC6EA5
GO
Isoform 2 (identifier: Q5SR56-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.
     344-376: MMWAAGTVAAMSSITFPAISALVSRNAESDQQG → SCPGDHNWNKRTMQWPGASTVWLHILHVPCGTD
     377-506: Missing.

Note: No experimental confirmation available.
Show »
Length:311
Mass (Da):34,048
Checksum:i8E5B8B10308D4ACF
GO

Sequence cautioni

The sequence AAI06063 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55274 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD96556 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti367S → T in BAB55274 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055401406V → L.1 PublicationCorresponds to variant rs17851857dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0566921 – 65Missing in isoform 2. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_056693344 – 376MMWAA…SDQQG → SCPGDHNWNKRTMQWPGAST VWLHILHVPCGTD in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_056694377 – 506Missing in isoform 2. 1 PublicationAdd BLAST130

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027659 mRNA. Translation: BAB55274.1. Different initiation.
AK300615 mRNA. Translation: BAG62308.1.
AL691447, AL358232 Genomic DNA. Translation: CAI13281.1.
AL358232, AL691447 Genomic DNA. Translation: CAI15197.1.
BC106062 mRNA. Translation: AAI06063.1. Different initiation.
BC021093 mRNA. Translation: AAH21093.2.
AK222836 mRNA. Translation: BAD96556.1. Different initiation.
CCDSiCCDS6710.2. [Q5SR56-1]
RefSeqiNP_115947.2. NM_032558.2. [Q5SR56-1]
XP_016870710.1. XM_017015221.1. [Q5SR56-2]
UniGeneiHs.555996.

Genome annotation databases

EnsembliENST00000375344; ENSP00000364493; ENSG00000148110. [Q5SR56-1]
GeneIDi84641.
KEGGihsa:84641.
UCSCiuc004aur.4. human. [Q5SR56-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027659 mRNA. Translation: BAB55274.1. Different initiation.
AK300615 mRNA. Translation: BAG62308.1.
AL691447, AL358232 Genomic DNA. Translation: CAI13281.1.
AL358232, AL691447 Genomic DNA. Translation: CAI15197.1.
BC106062 mRNA. Translation: AAI06063.1. Different initiation.
BC021093 mRNA. Translation: AAH21093.2.
AK222836 mRNA. Translation: BAD96556.1. Different initiation.
CCDSiCCDS6710.2. [Q5SR56-1]
RefSeqiNP_115947.2. NM_032558.2. [Q5SR56-1]
XP_016870710.1. XM_017015221.1. [Q5SR56-2]
UniGeneiHs.555996.

3D structure databases

ProteinModelPortaliQ5SR56.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124166. 2 interactors.
IntActiQ5SR56. 1 interactor.
STRINGi9606.ENSP00000364493.

Protein family/group databases

TCDBi2.A.1.2.30. the major facilitator superfamily (mfs).

PTM databases

iPTMnetiQ5SR56.
PhosphoSitePlusiQ5SR56.

Polymorphism and mutation databases

BioMutaiHIATL1.
DMDMi238054382.

Proteomic databases

EPDiQ5SR56.
MaxQBiQ5SR56.
PaxDbiQ5SR56.
PeptideAtlasiQ5SR56.
PRIDEiQ5SR56.

Protocols and materials databases

DNASUi84641.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375344; ENSP00000364493; ENSG00000148110. [Q5SR56-1]
GeneIDi84641.
KEGGihsa:84641.
UCSCiuc004aur.4. human. [Q5SR56-1]

Organism-specific databases

CTDi84641.
GeneCardsiHIATL1.
HGNCiHGNC:23376. MFSD14B.
HPAiHPA017978.
neXtProtiNX_Q5SR56.
OpenTargetsiENSG00000148110.
PharmGKBiPA142671691.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2816. Eukaryota.
ENOG410ZVCA. LUCA.
GeneTreeiENSGT00510000046502.
HOGENOMiHOG000007094.
HOVERGENiHBG051902.
InParanoidiQ5SR56.
OMAiIKYMPES.
OrthoDBiEOG091G088Z.
PhylomeDBiQ5SR56.
TreeFamiTF313511.

Miscellaneous databases

ChiTaRSiHIATL1. human.
GenomeRNAii84641.
PROiQ5SR56.

Gene expression databases

BgeeiENSG00000148110.
CleanExiHS_HIATL1.
ExpressionAtlasiQ5SR56. baseline and differential.
GenevisibleiQ5SR56. HS.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR011701. MFS.
IPR020846. MFS_dom.
IPR005829. Sugar_transporter_CS.
IPR001958. Tet-R_TetA/multi-R_MdtG.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
PRINTSiPR01035. TCRTETA.
SUPFAMiSSF103473. SSF103473. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMF14B_HUMAN
AccessioniPrimary (citable) accession number: Q5SR56
Secondary accession number(s): B4DUE6
, E9PD58, Q3KQT4, Q53GU5, Q8WU95, Q96SM4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: May 26, 2009
Last modified: November 2, 2016
This is version 105 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.