Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5SR56

- HIAL1_HUMAN

UniProt

Q5SR56 - HIAL1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Hippocampus abundant transcript-like protein 1

Gene

HIATL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. transporter activity Source: InterPro

GO - Biological processi

  1. transmembrane transport Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Transport

Protein family/group databases

TCDBi2.A.1.2.30. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Hippocampus abundant transcript-like protein 1
Gene namesi
Name:HIATL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:23376. HIATL1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4949ExtracellularSequence AnalysisAdd
BLAST
Transmembranei50 – 7021HelicalSequence AnalysisAdd
BLAST
Topological domaini71 – 8212CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei83 – 10321HelicalSequence AnalysisAdd
BLAST
Topological domaini104 – 1118ExtracellularSequence Analysis
Transmembranei112 – 13221HelicalSequence AnalysisAdd
BLAST
Topological domaini133 – 1342CytoplasmicSequence Analysis
Transmembranei135 – 15521HelicalSequence AnalysisAdd
BLAST
Topological domaini156 – 16813ExtracellularSequence AnalysisAdd
BLAST
Transmembranei169 – 18921HelicalSequence AnalysisAdd
BLAST
Topological domaini190 – 1967CytoplasmicSequence Analysis
Transmembranei197 – 21721HelicalSequence AnalysisAdd
BLAST
Topological domaini218 – 25538ExtracellularSequence AnalysisAdd
BLAST
Transmembranei256 – 27621HelicalSequence AnalysisAdd
BLAST
Topological domaini277 – 2815CytoplasmicSequence Analysis
Transmembranei282 – 30221HelicalSequence AnalysisAdd
BLAST
Topological domaini303 – 31917ExtracellularSequence AnalysisAdd
BLAST
Transmembranei320 – 34021HelicalSequence AnalysisAdd
BLAST
Topological domaini341 – 3411CytoplasmicSequence Analysis
Transmembranei342 – 36221HelicalSequence AnalysisAdd
BLAST
Topological domaini363 – 38725ExtracellularSequence AnalysisAdd
BLAST
Transmembranei388 – 40821HelicalSequence AnalysisAdd
BLAST
Topological domaini409 – 42820CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei429 – 44921HelicalSequence AnalysisAdd
BLAST
Topological domaini450 – 50657ExtracellularSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671691.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 506506Hippocampus abundant transcript-like protein 1PRO_0000239229Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi463 – 4631N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ5SR56.
PaxDbiQ5SR56.
PRIDEiQ5SR56.

PTM databases

PhosphoSiteiQ5SR56.

Expressioni

Gene expression databases

BgeeiQ5SR56.
CleanExiHS_HIATL1.
GenevestigatoriQ5SR56.

Organism-specific databases

HPAiHPA017978.

Interactioni

Protein-protein interaction databases

BioGridi124166. 2 interactions.
IntActiQ5SR56. 1 interaction.
STRINGi9606.ENSP00000364493.

Structurei

3D structure databases

ProteinModelPortaliQ5SR56.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the major facilitator superfamily.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0477.
GeneTreeiENSGT00510000046502.
HOGENOMiHOG000007094.
HOVERGENiHBG051902.
InParanoidiQ5SR56.
OMAiVSWGAQI.
OrthoDBiEOG712TW3.
PhylomeDBiQ5SR56.
TreeFamiTF313511.

Family and domain databases

InterProiIPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR005829. Sugar_transporter_CS.
IPR001958. Tet-R_TetA/multi-R_MdtG.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
PRINTSiPR01035. TCRTETA.
SUPFAMiSSF103473. SSF103473. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5SR56-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVEPPPELE EKAASEPEAG AMPEKRAGAQ AAGSTWLQGF GRPSVYHAAI
60 70 80 90 100
VIFLEFFAWG LLTTPMLTVL HETFSQHTFL MNGLIQGVKG LLSFLSAPLI
110 120 130 140 150
GALSDVWGRK PFLLGTVFFT CFPIPLMRIS PWWYFAMISV SGVFSVTFSV
160 170 180 190 200
IFAYVADVTQ EHERSTAYGW VSATFAASLV SSPAIGAYLS ASYGDSLVVL
210 220 230 240 250
VATVVALLDI CFILVAVPES LPEKMRPVSW GAQISWKQAD PFASLKKVGK
260 270 280 290 300
DSTVLLICIT VFLSYLPEAG QYSSFFLYLR QVIGFGSVKI AAFIAMVGIL
310 320 330 340 350
SIVAQTAFLS ILMRSLGNKN TVLLGLGFQM LQLAWYGFGS QAWMMWAAGT
360 370 380 390 400
VAAMSSITFP AISALVSRNA ESDQQGVAQG IITGIRGLCN GLGPALYGFI
410 420 430 440 450
FYMFHVELTE LGPKLNSNNV PLQGAVIPGP PFLFGACIVL MSFLVALFIP
460 470 480 490 500
EYSKASGVQK HSNSSSGSLT NTPERGSDED IEPLLQDSSI WELSSFEEPG

NQCTEL
Length:506
Mass (Da):54,545
Last modified:May 26, 2009 - v3
Checksum:i4CD09B8A06EC6EA5
GO
Isoform 2 (identifier: Q5SR56-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.
     344-376: MMWAAGTVAAMSSITFPAISALVSRNAESDQQG → SCPGDHNWNKRTMQWPGASTVWLHILHVPCGTD
     377-506: Missing.

Note: No experimental confirmation available.

Show »
Length:311
Mass (Da):34,048
Checksum:i8E5B8B10308D4ACF
GO

Sequence cautioni

The sequence AAI06063.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB55274.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAD96556.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti367 – 3671S → T in BAB55274. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti406 – 4061V → L.1 Publication
Corresponds to variant rs17851857 [ dbSNP | Ensembl ].
VAR_055401

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6565Missing in isoform 2. 1 PublicationVSP_056692Add
BLAST
Alternative sequencei344 – 37633MMWAA…SDQQG → SCPGDHNWNKRTMQWPGAST VWLHILHVPCGTD in isoform 2. 1 PublicationVSP_056693Add
BLAST
Alternative sequencei377 – 506130Missing in isoform 2. 1 PublicationVSP_056694Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027659 mRNA. Translation: BAB55274.1. Different initiation.
AK300615 mRNA. Translation: BAG62308.1.
AL691447, AL358232 Genomic DNA. Translation: CAI13281.1.
AL358232, AL691447 Genomic DNA. Translation: CAI15197.1.
BC106062 mRNA. Translation: AAI06063.1. Different initiation.
BC021093 mRNA. Translation: AAH21093.2.
AK222836 mRNA. Translation: BAD96556.1. Different initiation.
CCDSiCCDS6710.2. [Q5SR56-1]
RefSeqiNP_115947.2. NM_032558.2. [Q5SR56-1]
UniGeneiHs.555996.

Genome annotation databases

EnsembliENST00000375344; ENSP00000364493; ENSG00000148110. [Q5SR56-1]
GeneIDi84641.
KEGGihsa:84641.
UCSCiuc004aur.3. human. [Q5SR56-1]

Polymorphism databases

DMDMi238054382.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027659 mRNA. Translation: BAB55274.1 . Different initiation.
AK300615 mRNA. Translation: BAG62308.1 .
AL691447 , AL358232 Genomic DNA. Translation: CAI13281.1 .
AL358232 , AL691447 Genomic DNA. Translation: CAI15197.1 .
BC106062 mRNA. Translation: AAI06063.1 . Different initiation.
BC021093 mRNA. Translation: AAH21093.2 .
AK222836 mRNA. Translation: BAD96556.1 . Different initiation.
CCDSi CCDS6710.2. [Q5SR56-1 ]
RefSeqi NP_115947.2. NM_032558.2. [Q5SR56-1 ]
UniGenei Hs.555996.

3D structure databases

ProteinModelPortali Q5SR56.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124166. 2 interactions.
IntActi Q5SR56. 1 interaction.
STRINGi 9606.ENSP00000364493.

Protein family/group databases

TCDBi 2.A.1.2.30. the major facilitator superfamily (mfs).

PTM databases

PhosphoSitei Q5SR56.

Polymorphism databases

DMDMi 238054382.

Proteomic databases

MaxQBi Q5SR56.
PaxDbi Q5SR56.
PRIDEi Q5SR56.

Protocols and materials databases

DNASUi 84641.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000375344 ; ENSP00000364493 ; ENSG00000148110 . [Q5SR56-1 ]
GeneIDi 84641.
KEGGi hsa:84641.
UCSCi uc004aur.3. human. [Q5SR56-1 ]

Organism-specific databases

CTDi 84641.
GeneCardsi GC09P097136.
HGNCi HGNC:23376. HIATL1.
HPAi HPA017978.
neXtProti NX_Q5SR56.
PharmGKBi PA142671691.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0477.
GeneTreei ENSGT00510000046502.
HOGENOMi HOG000007094.
HOVERGENi HBG051902.
InParanoidi Q5SR56.
OMAi VSWGAQI.
OrthoDBi EOG712TW3.
PhylomeDBi Q5SR56.
TreeFami TF313511.

Miscellaneous databases

ChiTaRSi HIATL1. human.
GenomeRNAii 84641.
NextBioi 35475166.
PROi Q5SR56.

Gene expression databases

Bgeei Q5SR56.
CleanExi HS_HIATL1.
Genevestigatori Q5SR56.

Family and domain databases

InterProi IPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR005829. Sugar_transporter_CS.
IPR001958. Tet-R_TetA/multi-R_MdtG.
[Graphical view ]
Pfami PF07690. MFS_1. 1 hit.
[Graphical view ]
PRINTSi PR01035. TCRTETA.
SUPFAMi SSF103473. SSF103473. 1 hit.
PROSITEi PS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 143-506 (ISOFORM 1).
  2. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-406.
    Tissue: Skin.
  4. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 140-506 (ISOFORM 1).
    Tissue: Liver.

Entry informationi

Entry nameiHIAL1_HUMAN
AccessioniPrimary (citable) accession number: Q5SR56
Secondary accession number(s): B4DUE6
, E9PD58, Q3KQT4, Q53GU5, Q8WU95, Q96SM4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: May 26, 2009
Last modified: November 26, 2014
This is version 88 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3