Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5SQS7 (SH24B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 77. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
SH2 domain-containing protein 4B
Gene names
Name:SH2D4B
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length431 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence similarities

Contains 1 SH2 domain.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSH2 domain
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5SQS7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5SQS7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     61-61: R → RA
     329-431: IISREDAEAL...SPPDYHLLFE → GNYHCFRRRVTSGTLRTEGQPTRLPSVV
Isoform 3 (identifier: Q5SQS7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MLQQILHDMYIDPELLAELSDVQKHILFYKMREEQLRRWKERETWEALAQDEGLRPPKTKR → MLPEDSGGSPDAA
     285-285: V → VS
     329-431: IISREDAEAL...SPPDYHLLFE → GNYHCFRRRVTSGTLRTEGQPTRLPSVV
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 431431SH2 domain-containing protein 4B
PRO_0000308600

Regions

Domain325 – 41793SH2
Compositional bias92 – 223132Glu-rich

Natural variations

Alternative sequence1 – 6161MLQQI…PKTKR → MLPEDSGGSPDAA in isoform 3.
VSP_029009
Alternative sequence611R → RA in isoform 2.
VSP_029010
Alternative sequence2851V → VS in isoform 3.
VSP_029011
Alternative sequence329 – 431103IISRE…HLLFE → GNYHCFRRRVTSGTLRTEGQ PTRLPSVV in isoform 2 and isoform 3.
VSP_029012
Natural variant2371H → R.
Corresponds to variant rs7075840 [ dbSNP | Ensembl ].
VAR_056987
Natural variant2391S → L.
Corresponds to variant rs11817391 [ dbSNP | Ensembl ].
VAR_056988

Experimental info

Sequence conflict1481D → G in BAC85715. Ref.1
Sequence conflict1771Q → R in BAC85715. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 21, 2004. Version 1.
Checksum: 5AB83BC426B0F8E9

FASTA43151,232
        10         20         30         40         50         60 
MLQQILHDMY IDPELLAELS DVQKHILFYK MREEQLRRWK ERETWEALAQ DEGLRPPKTK 

        70         80         90        100        110        120 
RASDKHIQWL LGADGEVWVW IMGEGPGDKP YEEISEELIA ERARLQAQRE AEELWRQKEA 

       130        140        150        160        170        180 
EITKKFRDAL ANEKARILAE KWKVEMEDRK AAKVLEERIH EEFKRKEEEE RKRGEEQIRL 

       190        200        210        220        230        240 
QEEQRAKELY WTLKQAQLHC QASEKEEREW EEQLRRSKAA DEERSRRAQR ARDEYRHHSL 

       250        260        270        280        290        300 
RAIQKGTVAG LSSMFRELGQ SHEQEARLYH HLPDPGLPQP LALPVRTWER PLRPVSRDVI 

       310        320        330        340        350        360 
VRWFKEEQLP RRAGFERNTK FIAPWFHGII SREDAEALLE NMTEGAFLVR VSEKIWGYTL 

       370        380        390        400        410        420 
SYRLQKGFKH FLVDASGDFY SFLGVDPNRH ATLTDLVDFH KEEIITVSGG ELLQEPCGQR 

       430 
DSPPDYHLLF E 

« Hide

Isoform 2 [UniParc].

Checksum: FC26E899C3C35E9D
Show »

FASTA35742,756
Isoform 3 [UniParc].

Checksum: 2ADACD02D1D4DBDD
Show »

FASTA30936,467

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Tissue: Brain and Spleen.
[2]"The DNA sequence and comparative analysis of human chromosome 10."
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. expand/collapse author list , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK123885 mRNA. Translation: BAC85715.1.
AK123978 mRNA. Translation: BAC85741.1.
AL731544, AC021028 Genomic DNA. Translation: CAI14997.1.
AL731544, AC021028 Genomic DNA. Translation: CAI14998.1.
RefSeqNP_001139191.1. NM_001145719.1.
NP_997255.2. NM_207372.2.
UniGeneHs.147643.

3D structure databases

ProteinModelPortalQ5SQS7.
SMRQ5SQS7. Positions 322-424.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000345295.

PTM databases

PhosphoSiteQ5SQS7.

Polymorphism databases

DMDM74743565.

Proteomic databases

PaxDbQ5SQS7.
PRIDEQ5SQS7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000313455; ENSP00000314242; ENSG00000178217. [Q5SQS7-3]
ENST00000339284; ENSP00000345295; ENSG00000178217. [Q5SQS7-2]
ENST00000470604; ENSP00000417953; ENSG00000178217. [Q5SQS7-1]
GeneID387694.
KEGGhsa:387694.
UCSCuc001kck.1. human. [Q5SQS7-2]
uc001kcl.1. human. [Q5SQS7-3]

Organism-specific databases

CTD387694.
GeneCardsGC10P082297.
HGNCHGNC:31440. SH2D4B.
HPAHPA040022.
neXtProtNX_Q5SQS7.
PharmGKBPA134943660.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG77708.
HOGENOMHOG000031527.
HOVERGENHBG057918.
InParanoidQ5SQS7.
OMAVRWFKEE.
OrthoDBEOG71P2BD.
PhylomeDBQ5SQS7.
TreeFamTF336893.

Enzyme and pathway databases

SignaLinkQ5SQS7.

Gene expression databases

BgeeQ5SQS7.
CleanExHS_SH2D4B.
GenevestigatorQ5SQS7.

Family and domain databases

Gene3D3.30.505.10. 1 hit.
InterProIPR000980. SH2.
[Graphical view]
PfamPF00017. SH2. 1 hit.
[Graphical view]
PRINTSPR00401. SH2DOMAIN.
SMARTSM00252. SH2. 1 hit.
[Graphical view]
SUPFAMSSF55550. SSF55550. 1 hit.
PROSITEPS50001. SH2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi387694.
NextBio101513.
PROQ5SQS7.

Entry information

Entry nameSH24B_HUMAN
AccessionPrimary (citable) accession number: Q5SQS7
Secondary accession number(s): Q5SQS5, Q6ZVW9, Q6ZVZ3
Entry history
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: December 21, 2004
Last modified: April 16, 2014
This is version 77 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 10

Human chromosome 10: entries, gene names and cross-references to MIM