SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5SQS7

- SH24B_HUMAN

UniProt

Q5SQS7 - SH24B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

SH2 domain-containing protein 4B

Gene
SH2D4B
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ5SQS7.

Names & Taxonomyi

Protein namesi
Recommended name:
SH2 domain-containing protein 4B
Gene namesi
Name:SH2D4B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:31440. SH2D4B.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134943660.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 431431SH2 domain-containing protein 4BPRO_0000308600Add
BLAST

Proteomic databases

PaxDbiQ5SQS7.
PRIDEiQ5SQS7.

PTM databases

PhosphoSiteiQ5SQS7.

Expressioni

Gene expression databases

BgeeiQ5SQS7.
CleanExiHS_SH2D4B.
GenevestigatoriQ5SQS7.

Organism-specific databases

HPAiHPA040022.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000345295.

Structurei

3D structure databases

ProteinModelPortaliQ5SQS7.
SMRiQ5SQS7. Positions 322-424.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini325 – 41793SH2Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi92 – 223132Glu-richAdd
BLAST

Sequence similaritiesi

Contains 1 SH2 domain.

Keywords - Domaini

SH2 domain

Phylogenomic databases

eggNOGiNOG77708.
HOGENOMiHOG000031527.
HOVERGENiHBG057918.
InParanoidiQ5SQS7.
OMAiVRWFKEE.
OrthoDBiEOG71P2BD.
PhylomeDBiQ5SQS7.
TreeFamiTF336893.

Family and domain databases

Gene3Di3.30.505.10. 1 hit.
InterProiIPR000980. SH2.
[Graphical view]
PfamiPF00017. SH2. 1 hit.
[Graphical view]
PRINTSiPR00401. SH2DOMAIN.
SMARTiSM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF55550. SSF55550. 1 hit.
PROSITEiPS50001. SH2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5SQS7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLQQILHDMY IDPELLAELS DVQKHILFYK MREEQLRRWK ERETWEALAQ    50
DEGLRPPKTK RASDKHIQWL LGADGEVWVW IMGEGPGDKP YEEISEELIA 100
ERARLQAQRE AEELWRQKEA EITKKFRDAL ANEKARILAE KWKVEMEDRK 150
AAKVLEERIH EEFKRKEEEE RKRGEEQIRL QEEQRAKELY WTLKQAQLHC 200
QASEKEEREW EEQLRRSKAA DEERSRRAQR ARDEYRHHSL RAIQKGTVAG 250
LSSMFRELGQ SHEQEARLYH HLPDPGLPQP LALPVRTWER PLRPVSRDVI 300
VRWFKEEQLP RRAGFERNTK FIAPWFHGII SREDAEALLE NMTEGAFLVR 350
VSEKIWGYTL SYRLQKGFKH FLVDASGDFY SFLGVDPNRH ATLTDLVDFH 400
KEEIITVSGG ELLQEPCGQR DSPPDYHLLF E 431
Length:431
Mass (Da):51,232
Last modified:December 21, 2004 - v1
Checksum:i5AB83BC426B0F8E9
GO
Isoform 2 (identifier: Q5SQS7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     61-61: R → RA
     329-431: IISREDAEAL...SPPDYHLLFE → GNYHCFRRRVTSGTLRTEGQPTRLPSVV

Show »
Length:357
Mass (Da):42,756
Checksum:iFC26E899C3C35E9D
GO
Isoform 3 (identifier: Q5SQS7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MLQQILHDMYIDPELLAELSDVQKHILFYKMREEQLRRWKERETWEALAQDEGLRPPKTKR → MLPEDSGGSPDAA
     285-285: V → VS
     329-431: IISREDAEAL...SPPDYHLLFE → GNYHCFRRRVTSGTLRTEGQPTRLPSVV

Note: No experimental confirmation available.

Show »
Length:309
Mass (Da):36,467
Checksum:i2ADACD02D1D4DBDD
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti237 – 2371H → R.
Corresponds to variant rs7075840 [ dbSNP | Ensembl ].
VAR_056987
Natural varianti239 – 2391S → L.
Corresponds to variant rs11817391 [ dbSNP | Ensembl ].
VAR_056988

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6161MLQQI…PKTKR → MLPEDSGGSPDAA in isoform 3. VSP_029009Add
BLAST
Alternative sequencei61 – 611R → RA in isoform 2. VSP_029010
Alternative sequencei285 – 2851V → VS in isoform 3. VSP_029011
Alternative sequencei329 – 431103IISRE…HLLFE → GNYHCFRRRVTSGTLRTEGQ PTRLPSVV in isoform 2 and isoform 3. VSP_029012Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti148 – 1481D → G in BAC85715. 1 Publication
Sequence conflicti177 – 1771Q → R in BAC85715. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK123885 mRNA. Translation: BAC85715.1.
AK123978 mRNA. Translation: BAC85741.1.
AL731544, AC021028 Genomic DNA. Translation: CAI14997.1.
AL731544, AC021028 Genomic DNA. Translation: CAI14998.1.
CCDSiCCDS44449.1. [Q5SQS7-3]
CCDS7370.1. [Q5SQS7-2]
RefSeqiNP_001139191.1. NM_001145719.1. [Q5SQS7-3]
NP_997255.2. NM_207372.2. [Q5SQS7-2]
UniGeneiHs.147643.

Genome annotation databases

EnsembliENST00000313455; ENSP00000314242; ENSG00000178217. [Q5SQS7-3]
ENST00000339284; ENSP00000345295; ENSG00000178217. [Q5SQS7-2]
ENST00000470604; ENSP00000417953; ENSG00000178217. [Q5SQS7-1]
GeneIDi387694.
KEGGihsa:387694.
UCSCiuc001kck.1. human. [Q5SQS7-2]
uc001kcl.1. human. [Q5SQS7-3]

Polymorphism databases

DMDMi74743565.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK123885 mRNA. Translation: BAC85715.1 .
AK123978 mRNA. Translation: BAC85741.1 .
AL731544 , AC021028 Genomic DNA. Translation: CAI14997.1 .
AL731544 , AC021028 Genomic DNA. Translation: CAI14998.1 .
CCDSi CCDS44449.1. [Q5SQS7-3 ]
CCDS7370.1. [Q5SQS7-2 ]
RefSeqi NP_001139191.1. NM_001145719.1. [Q5SQS7-3 ]
NP_997255.2. NM_207372.2. [Q5SQS7-2 ]
UniGenei Hs.147643.

3D structure databases

ProteinModelPortali Q5SQS7.
SMRi Q5SQS7. Positions 322-424.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000345295.

PTM databases

PhosphoSitei Q5SQS7.

Polymorphism databases

DMDMi 74743565.

Proteomic databases

PaxDbi Q5SQS7.
PRIDEi Q5SQS7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000313455 ; ENSP00000314242 ; ENSG00000178217 . [Q5SQS7-3 ]
ENST00000339284 ; ENSP00000345295 ; ENSG00000178217 . [Q5SQS7-2 ]
ENST00000470604 ; ENSP00000417953 ; ENSG00000178217 . [Q5SQS7-1 ]
GeneIDi 387694.
KEGGi hsa:387694.
UCSCi uc001kck.1. human. [Q5SQS7-2 ]
uc001kcl.1. human. [Q5SQS7-3 ]

Organism-specific databases

CTDi 387694.
GeneCardsi GC10P082297.
HGNCi HGNC:31440. SH2D4B.
HPAi HPA040022.
neXtProti NX_Q5SQS7.
PharmGKBi PA134943660.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG77708.
HOGENOMi HOG000031527.
HOVERGENi HBG057918.
InParanoidi Q5SQS7.
OMAi VRWFKEE.
OrthoDBi EOG71P2BD.
PhylomeDBi Q5SQS7.
TreeFami TF336893.

Enzyme and pathway databases

SignaLinki Q5SQS7.

Miscellaneous databases

GenomeRNAii 387694.
NextBioi 101513.
PROi Q5SQS7.

Gene expression databases

Bgeei Q5SQS7.
CleanExi HS_SH2D4B.
Genevestigatori Q5SQS7.

Family and domain databases

Gene3Di 3.30.505.10. 1 hit.
InterProi IPR000980. SH2.
[Graphical view ]
Pfami PF00017. SH2. 1 hit.
[Graphical view ]
PRINTSi PR00401. SH2DOMAIN.
SMARTi SM00252. SH2. 1 hit.
[Graphical view ]
SUPFAMi SSF55550. SSF55550. 1 hit.
PROSITEi PS50001. SH2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain and Spleen.
  2. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiSH24B_HUMAN
AccessioniPrimary (citable) accession number: Q5SQS7
Secondary accession number(s): Q5SQS5, Q6ZVW9, Q6ZVZ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: December 21, 2004
Last modified: July 9, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi