Q5SQS7 (SH24B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 68.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SH2 domain-containing protein 4B | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 431 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Contains 1 SH2 domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | SH2 domain |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5SQS7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5SQS7-2) The sequence of this isoform differs from the canonical sequence as follows: 61-61: R → RA 329-431: IISREDAEAL...SPPDYHLLFE → GNYHCFRRRVTSGTLRTEGQPTRLPSVV | ||||||
| Isoform 3 (identifier: Q5SQS7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-61: MLQQILHDMYIDPELLAELSDVQKHILFYKMREEQLRRWKERETWEALAQDEGLRPPKTKR → MLPEDSGGSPDAA 285-285: V → VS 329-431: IISREDAEAL...SPPDYHLLFE → GNYHCFRRRVTSGTLRTEGQPTRLPSVV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 431 | 431 | SH2 domain-containing protein 4B | PRO_0000308600 | |||||
Regions | |||||||||
| Domain | 325 – 417 | 93 | SH2 | ||||||
| Compositional bias | 92 – 223 | 132 | Glu-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 61 | 61 | MLQQI…PKTKR → MLPEDSGGSPDAA in isoform 3. | VSP_029009 | |||||
| Alternative sequence | 61 | 1 | R → RA in isoform 2. | VSP_029010 | |||||
| Alternative sequence | 285 | 1 | V → VS in isoform 3. | VSP_029011 | |||||
| Alternative sequence | 329 – 431 | 103 | IISRE…HLLFE → GNYHCFRRRVTSGTLRTEGQ PTRLPSVV in isoform 2 and isoform 3. | VSP_029012 | |||||
| Natural variant | 237 | 1 | H → R. Corresponds to variant rs7075840 [ dbSNP | Ensembl ]. | VAR_056987 | |||||
| Natural variant | 239 | 1 | S → L. Corresponds to variant rs11817391 [ dbSNP | Ensembl ]. | VAR_056988 | |||||
Experimental info | |||||||||
| Sequence conflict | 148 | 1 | D → G in BAC85715. Ref.1 | ||||||
| Sequence conflict | 177 | 1 | Q → R in BAC85715. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Brain and Spleen. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK123885 mRNA. Translation: BAC85715.1. AK123978 mRNA. Translation: BAC85741.1. AL731544, AC021028 Genomic DNA. Translation: CAI14997.1. AL731544, AC021028 Genomic DNA. Translation: CAI14998.1. |
| IPI | IPI00410443. IPI00514668. IPI00869143. |
| RefSeq | NP_001139191.1. NM_001145719.1. NP_997255.2. NM_207372.2. |
| UniGene | Hs.147643. |
3D structure databases | |
| HSSP | HSSP built from PDB template 2CS0 based on UniProtKB Q96JZ2. |
| ProteinModelPortal | Q5SQS7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000345295. |
PTM databases | |
| PhosphoSite | Q5SQS7. |
Polymorphism databases | |
| DMDM | 74743565. |
Proteomic databases | |
| PaxDb | Q5SQS7. |
| PRIDE | Q5SQS7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000313455; ENSP00000314242; ENSG00000178217. ENST00000339284; ENSP00000345295; ENSG00000178217. ENST00000470604; ENSP00000417953; ENSG00000178217. |
| GeneID | 387694. |
| KEGG | hsa:387694. |
| UCSC | uc001kck.1. human. uc001kcl.1. human. |
Organism-specific databases | |
| CTD | 387694. |
| GeneCards | GC10P082297. |
| HGNC | HGNC:31440. SH2D4B. |
| HPA | HPA040022. |
| neXtProt | NX_Q5SQS7. |
| PharmGKB | PA134943660. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG77708. |
| HOGENOM | HOG000031527. |
| HOVERGEN | HBG057918. |
| InParanoid | Q5SQS7. |
| OMA | SMFQELG. |
Gene expression databases | |
| ArrayExpress | Q5SQS7. |
| Bgee | Q5SQS7. |
| CleanEx | HS_SH2D4B. |
| Genevestigator | Q5SQS7. |
Family and domain databases | |
| Gene3D | 3.30.505.10. 1 hit. |
| InterPro | IPR000980. SH2. [Graphical view] |
| Pfam | PF00017. SH2. 1 hit. [Graphical view] |
| PRINTS | PR00401. SH2DOMAIN. |
| SMART | SM00252. SH2. 1 hit. [Graphical view] |
| PROSITE | PS50001. SH2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 387694. |
| NextBio | 101513. |
Entry information
| Entry name | SH24B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5SQS7 Secondary accession number(s): Q5SQS5, Q6ZVW9, Q6ZVZ3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
