Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5SQS7

- SH24B_HUMAN

UniProt

Q5SQS7 - SH24B_HUMAN

Protein

SH2 domain-containing protein 4B

Gene

SH2D4B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 80 (01 Oct 2014)
      Sequence version 1 (21 Dec 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Enzyme and pathway databases

    SignaLinkiQ5SQS7.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    SH2 domain-containing protein 4B
    Gene namesi
    Name:SH2D4B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:31440. SH2D4B.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134943660.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 431431SH2 domain-containing protein 4BPRO_0000308600Add
    BLAST

    Proteomic databases

    PaxDbiQ5SQS7.
    PRIDEiQ5SQS7.

    PTM databases

    PhosphoSiteiQ5SQS7.

    Expressioni

    Gene expression databases

    BgeeiQ5SQS7.
    CleanExiHS_SH2D4B.
    GenevestigatoriQ5SQS7.

    Organism-specific databases

    HPAiHPA040022.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000345295.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5SQS7.
    SMRiQ5SQS7. Positions 322-424.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini325 – 41793SH2PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi92 – 223132Glu-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 SH2 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    SH2 domain

    Phylogenomic databases

    eggNOGiNOG77708.
    HOGENOMiHOG000031527.
    HOVERGENiHBG057918.
    InParanoidiQ5SQS7.
    OMAiVRWFKEE.
    OrthoDBiEOG71P2BD.
    PhylomeDBiQ5SQS7.
    TreeFamiTF336893.

    Family and domain databases

    Gene3Di3.30.505.10. 1 hit.
    InterProiIPR000980. SH2.
    [Graphical view]
    PfamiPF00017. SH2. 1 hit.
    [Graphical view]
    PRINTSiPR00401. SH2DOMAIN.
    SMARTiSM00252. SH2. 1 hit.
    [Graphical view]
    SUPFAMiSSF55550. SSF55550. 1 hit.
    PROSITEiPS50001. SH2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5SQS7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLQQILHDMY IDPELLAELS DVQKHILFYK MREEQLRRWK ERETWEALAQ    50
    DEGLRPPKTK RASDKHIQWL LGADGEVWVW IMGEGPGDKP YEEISEELIA 100
    ERARLQAQRE AEELWRQKEA EITKKFRDAL ANEKARILAE KWKVEMEDRK 150
    AAKVLEERIH EEFKRKEEEE RKRGEEQIRL QEEQRAKELY WTLKQAQLHC 200
    QASEKEEREW EEQLRRSKAA DEERSRRAQR ARDEYRHHSL RAIQKGTVAG 250
    LSSMFRELGQ SHEQEARLYH HLPDPGLPQP LALPVRTWER PLRPVSRDVI 300
    VRWFKEEQLP RRAGFERNTK FIAPWFHGII SREDAEALLE NMTEGAFLVR 350
    VSEKIWGYTL SYRLQKGFKH FLVDASGDFY SFLGVDPNRH ATLTDLVDFH 400
    KEEIITVSGG ELLQEPCGQR DSPPDYHLLF E 431
    Length:431
    Mass (Da):51,232
    Last modified:December 21, 2004 - v1
    Checksum:i5AB83BC426B0F8E9
    GO
    Isoform 2 (identifier: Q5SQS7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         61-61: R → RA
         329-431: IISREDAEAL...SPPDYHLLFE → GNYHCFRRRVTSGTLRTEGQPTRLPSVV

    Show »
    Length:357
    Mass (Da):42,756
    Checksum:iFC26E899C3C35E9D
    GO
    Isoform 3 (identifier: Q5SQS7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-61: MLQQILHDMYIDPELLAELSDVQKHILFYKMREEQLRRWKERETWEALAQDEGLRPPKTKR → MLPEDSGGSPDAA
         285-285: V → VS
         329-431: IISREDAEAL...SPPDYHLLFE → GNYHCFRRRVTSGTLRTEGQPTRLPSVV

    Note: No experimental confirmation available.

    Show »
    Length:309
    Mass (Da):36,467
    Checksum:i2ADACD02D1D4DBDD
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti148 – 1481D → G in BAC85715. (PubMed:14702039)Curated
    Sequence conflicti177 – 1771Q → R in BAC85715. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti237 – 2371H → R.
    Corresponds to variant rs7075840 [ dbSNP | Ensembl ].
    VAR_056987
    Natural varianti239 – 2391S → L.
    Corresponds to variant rs11817391 [ dbSNP | Ensembl ].
    VAR_056988

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6161MLQQI…PKTKR → MLPEDSGGSPDAA in isoform 3. 1 PublicationVSP_029009Add
    BLAST
    Alternative sequencei61 – 611R → RA in isoform 2. 1 PublicationVSP_029010
    Alternative sequencei285 – 2851V → VS in isoform 3. 1 PublicationVSP_029011
    Alternative sequencei329 – 431103IISRE…HLLFE → GNYHCFRRRVTSGTLRTEGQ PTRLPSVV in isoform 2 and isoform 3. 1 PublicationVSP_029012Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK123885 mRNA. Translation: BAC85715.1.
    AK123978 mRNA. Translation: BAC85741.1.
    AL731544, AC021028 Genomic DNA. Translation: CAI14997.1.
    AL731544, AC021028 Genomic DNA. Translation: CAI14998.1.
    CCDSiCCDS44449.1. [Q5SQS7-3]
    CCDS7370.1. [Q5SQS7-2]
    RefSeqiNP_001139191.1. NM_001145719.1. [Q5SQS7-3]
    NP_997255.2. NM_207372.2. [Q5SQS7-2]
    UniGeneiHs.147643.

    Genome annotation databases

    EnsembliENST00000313455; ENSP00000314242; ENSG00000178217. [Q5SQS7-3]
    ENST00000339284; ENSP00000345295; ENSG00000178217. [Q5SQS7-2]
    GeneIDi387694.
    KEGGihsa:387694.
    UCSCiuc001kck.1. human. [Q5SQS7-2]
    uc001kcl.1. human. [Q5SQS7-3]

    Polymorphism databases

    DMDMi74743565.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK123885 mRNA. Translation: BAC85715.1 .
    AK123978 mRNA. Translation: BAC85741.1 .
    AL731544 , AC021028 Genomic DNA. Translation: CAI14997.1 .
    AL731544 , AC021028 Genomic DNA. Translation: CAI14998.1 .
    CCDSi CCDS44449.1. [Q5SQS7-3 ]
    CCDS7370.1. [Q5SQS7-2 ]
    RefSeqi NP_001139191.1. NM_001145719.1. [Q5SQS7-3 ]
    NP_997255.2. NM_207372.2. [Q5SQS7-2 ]
    UniGenei Hs.147643.

    3D structure databases

    ProteinModelPortali Q5SQS7.
    SMRi Q5SQS7. Positions 322-424.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000345295.

    PTM databases

    PhosphoSitei Q5SQS7.

    Polymorphism databases

    DMDMi 74743565.

    Proteomic databases

    PaxDbi Q5SQS7.
    PRIDEi Q5SQS7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000313455 ; ENSP00000314242 ; ENSG00000178217 . [Q5SQS7-3 ]
    ENST00000339284 ; ENSP00000345295 ; ENSG00000178217 . [Q5SQS7-2 ]
    GeneIDi 387694.
    KEGGi hsa:387694.
    UCSCi uc001kck.1. human. [Q5SQS7-2 ]
    uc001kcl.1. human. [Q5SQS7-3 ]

    Organism-specific databases

    CTDi 387694.
    GeneCardsi GC10P082297.
    HGNCi HGNC:31440. SH2D4B.
    HPAi HPA040022.
    neXtProti NX_Q5SQS7.
    PharmGKBi PA134943660.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG77708.
    HOGENOMi HOG000031527.
    HOVERGENi HBG057918.
    InParanoidi Q5SQS7.
    OMAi VRWFKEE.
    OrthoDBi EOG71P2BD.
    PhylomeDBi Q5SQS7.
    TreeFami TF336893.

    Enzyme and pathway databases

    SignaLinki Q5SQS7.

    Miscellaneous databases

    GenomeRNAii 387694.
    NextBioi 101513.
    PROi Q5SQS7.

    Gene expression databases

    Bgeei Q5SQS7.
    CleanExi HS_SH2D4B.
    Genevestigatori Q5SQS7.

    Family and domain databases

    Gene3Di 3.30.505.10. 1 hit.
    InterProi IPR000980. SH2.
    [Graphical view ]
    Pfami PF00017. SH2. 1 hit.
    [Graphical view ]
    PRINTSi PR00401. SH2DOMAIN.
    SMARTi SM00252. SH2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF55550. SSF55550. 1 hit.
    PROSITEi PS50001. SH2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Brain and Spleen.
    2. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiSH24B_HUMAN
    AccessioniPrimary (citable) accession number: Q5SQS7
    Secondary accession number(s): Q5SQS5, Q6ZVW9, Q6ZVZ3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 23, 2007
    Last sequence update: December 21, 2004
    Last modified: October 1, 2014
    This is version 80 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3