Q5SQN1 (SNP47_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 67.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Synaptosomal-associated protein 47 Short name=SNAP-47 Alternative name(s): Epididymis luminal protein 170 Synaptosomal-associated 47 kDa protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 464 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in intracellular membrane fusion By similarity. |
| Subunit structure | Forms a complex containing SNAP47, VAMP2 and STX1A By similarity. Associates with the BLOC-1 complex. Interacts with BLOC1S6. Ref.8 |
| Subcellular location | Endomembrane system By similarity. Cytoplasm › perinuclear region By similarity. Note: Appears to be exclusively membrane-bound By similarity. |
| Sequence similarities | Belongs to the SVAP1 family. Contains 2 t-SNARE coiled-coil homology domains. |
| Sequence caution | The sequence BAB70779.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Repeat |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | endomembrane system Inferred from electronic annotation. Source: UniProtKB-SubCell membraneInferred from electronic annotation. Source: UniProtKB-KW perinuclear region of cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5SQN1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5SQN1-2) The sequence of this isoform differs from the canonical sequence as follows: 417-464: ILRRMKGLAL...KHNRRMKRLT → GFRPMSLSTQTVLVMLCSESAGALWRQRLS | ||||||
| Isoform 3 (identifier: Q5SQN1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-242: Missing. 417-464: ILRRMKGLAL...KHNRRMKRLT → GFRPMSLSTQTVLVMLCSESAGALWRQRLS | ||||||
| Isoform 4 (identifier: Q5SQN1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-242: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 464 | 464 | Synaptosomal-associated protein 47 | PRO_0000307151 | |||||
Regions | |||||||||
| Domain | 154 – 216 | 63 | t-SNARE coiled-coil homology 1 | ||||||
| Domain | 401 – 463 | 63 | t-SNARE coiled-coil homology 2 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 242 | 242 | Missing in isoform 3 and isoform 4. | VSP_028613 | |||||
| Alternative sequence | 417 – 464 | 48 | ILRRM…MKRLT → GFRPMSLSTQTVLVMLCSES AGALWRQRLS in isoform 2 and isoform 3. | VSP_028614 | |||||
| Natural variant | 48 | 1 | R → G. Corresponds to variant rs2236359 [ dbSNP | Ensembl ]. | VAR_035367 | |||||
| Natural variant | 119 | 1 | G → R. Ref.5 Corresponds to variant rs12239037 [ dbSNP | Ensembl ]. | VAR_035368 | |||||
| Natural variant | 154 | 1 | V → M. Ref.1 Ref.5 Corresponds to variant rs2236358 [ dbSNP | Ensembl ]. | VAR_035369 | |||||
| Natural variant | 381 | 1 | R → C. Ref.5 Ref.6 Corresponds to variant rs17851681 [ dbSNP | Ensembl ]. | VAR_035370 | |||||
Experimental info | |||||||||
| Sequence conflict | 84 – 86 | 3 | DST → TRP in AAH01332. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Homo sapiens GRASP protein." Yang J., Qiu Y. Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-154. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Colon endothelium. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANTS ARG-119; MET-154 AND CYS-381. Tissue: Cervix, Kidney, Lung, Muscle, Ovary, Pancreas and Placenta. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 10-464 (ISOFORM 2), VARIANT CYS-381. Tissue: Astrocyte. |
| [7] | Li J., Wang H. Submitted (SEP-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 30-464 (ISOFORM 1). |
| [8] | "The dysbindin-containing complex (BLOC-1) in brain: developmental regulation, interaction with SNARE proteins and role in neurite outgrowth." Ghiani C.A., Starcevic M., Rodriguez-Fernandez I.A., Nazarian R., Cheli V.T., Chan L.N., Malvar J.S., de Vellis J., Sabatti C., Dell'Angelica E.C. Mol. Psychiatry 15:204-215(2010) [PubMed] [Europe PMC] [Abstract] Cited for: ASSOCIATION WITH THE BLOC-1 COMPLEX, INTERACTION WITH BLOC1S6. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY090635 mRNA. Translation: AAM09082.1. BX648570 mRNA. Translation: CAI45994.1. AL731702, AL136378 Genomic DNA. Translation: CAI21075.1. AL731702, AL136378 Genomic DNA. Translation: CAI21076.1. AL136378, AL731702 Genomic DNA. Translation: CAI23069.1. AL136378 Genomic DNA. Translation: CAI23071.1. AL136378, AL731702 Genomic DNA. Translation: CAI23072.1. CH471098 Genomic DNA. Translation: EAW69817.1. BC001332 mRNA. Translation: AAH01332.1. BC004418 mRNA. Translation: AAH04418.1. BC007786 mRNA. Translation: AAH07786.2. BC011145 mRNA. Translation: AAH11145.1. BC014059 mRNA. Translation: AAH14059.2. BC018760 mRNA. Translation: AAH18760.2. BC025231 mRNA. Translation: AAH25231.1. BC032775 mRNA. Translation: AAH32775.1. AK054633 mRNA. Translation: BAB70779.1. Different initiation. FJ236305 mRNA. Translation: ACI45237.1. |
| IPI | IPI00289433. IPI00291292. IPI00639909. IPI00641526. |
| RefSeq | NP_444280.2. NM_053052.3. |
| UniGene | Hs.325081. |
3D structure databases | |
| ProteinModelPortal | Q5SQN1. |
| SMR | Q5SQN1. Positions 164-216, 408-460. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q5SQN1. |
Polymorphism databases | |
| DMDM | 238054367. |
Proteomic databases | |
| PaxDb | Q5SQN1. |
| PRIDE | Q5SQN1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000315781; ENSP00000314157; ENSG00000143740. ENST00000366759; ENSP00000355721; ENSG00000143740. ENST00000366760; ENSP00000355722; ENSG00000143740. |
| GeneID | 116841. |
| KEGG | hsa:116841. |
| UCSC | uc001hra.2. human. uc001hrd.3. human. uc001hre.3. human. uc001hrf.2. human. |
Organism-specific databases | |
| CTD | 116841. |
| GeneCards | GC01P227917. |
| H-InvDB | HIX0023151. |
| HGNC | HGNC:30669. SNAP47. |
| HPA | HPA028167. |
| neXtProt | NX_Q5SQN1. |
| PharmGKB | PA164725983. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG261157. |
| HOVERGEN | HBG057915. |
| InParanoid | Q5SQN1. |
| KO | K08509. |
| OMA | LEHFWRE. |
| PhylomeDB | Q5SQN1. |
Gene expression databases | |
| ArrayExpress | Q5SQN1. |
| Bgee | Q5SQN1. |
| CleanEx | HS_SNAP47. |
| Genevestigator | Q5SQN1. |
Family and domain databases | |
| InterPro | IPR000727. T_SNARE_dom. [Graphical view] |
| PROSITE | PS50192. T_SNARE. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 116841. |
| NextBio | 80008. |
Entry information
| Entry name | SNP47_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5SQN1 Secondary accession number(s): B6EDE0 Q9BVB2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
