Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lymphocyte antigen 6 complex locus protein G6f

Gene

LY6G6F

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in the downstream signal transduction pathways involving GRB2 and GRB7.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
Lymphocyte antigen 6 complex locus protein G6f
Gene namesi
Name:LY6G6F
Synonyms:C6orf21, G6F, LY6G6D, NG32
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:13933. LY6G6F.

Subcellular locationi

  • Cell membrane 1 Publication; Single-pass type I membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini17 – 235219ExtracellularSequence analysisAdd
BLAST
Transmembranei236 – 25621HelicalSequence analysisAdd
BLAST
Topological domaini257 – 29741CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi281 – 2811Y → F: No phosphorylation. No interaction with GRB2 and GRB7. No phosphorylation increase of p42/44 MAP kinase. 1 Publication

Organism-specific databases

PharmGKBiPA38371.

Polymorphism and mutation databases

BioMutaiLY6G6F.
DMDMi172045922.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616Sequence analysisAdd
BLAST
Chaini17 – 297281Lymphocyte antigen 6 complex locus protein G6fPRO_0000318923Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi35 ↔ 106PROSITE-ProRule annotation
Glycosylationi88 – 881N-linked (GlcNAc...)1 Publication
Modified residuei281 – 2811Phosphotyrosine1 Publication

Post-translational modificationi

N-glycosylated.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ5SQ64.
PRIDEiQ5SQ64.

PTM databases

iPTMnetiQ5SQ64.

Expressioni

Gene expression databases

BgeeiQ5SQ64.
CleanExiHS_LY6G6D.
HS_LY6G6F.
GenevisibleiQ5SQ64. HS.

Organism-specific databases

HPAiHPA008053.

Interactioni

Subunit structurei

Homodimer; disulfide-linked. Interacts with GRB2 and GRB7 in a phosphorylation-dependent manner.1 Publication

Protein-protein interaction databases

BioGridi129225. 2 interactions.
IntActiQ5SQ64. 2 interactions.
MINTiMINT-8020134.
STRINGi9606.ENSP00000364992.

Structurei

3D structure databases

ProteinModelPortaliQ5SQ64.
SMRiQ5SQ64. Positions 21-165.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini17 – 122106Ig-like V-typeAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJZB. Eukaryota.
ENOG41116W2. LUCA.
GeneTreeiENSGT00390000015960.
HOGENOMiHOG000043066.
HOVERGENiHBG053329.
InParanoidiQ5SQ64.
OMAiASACITA.
OrthoDBiEOG7FJH19.
PhylomeDBiQ5SQ64.
TreeFamiTF337100.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR026524. LY6G6d/LY6G6f.
[Graphical view]
PANTHERiPTHR32286. PTHR32286. 1 hit.
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5SQ64-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVLFLLLFL CGTPQAADNM QAIYVALGEA VELPCPSPPT LHGDEHLSWF
60 70 80 90 100
CSPAAGSFTT LVAQVQVGRP APDPGKPGRE SRLRLLGNYS LWLEGSKEED
110 120 130 140 150
AGRYWCAVLG QHHNYQNWRV YDVLVLKGSQ LSARAADGSP CNVLLCSVVP
160 170 180 190 200
SRRMDSVTWQ EGKGPVRGRV QSFWGSEAAL LLVCPGEGLS EPRSRRPRII
210 220 230 240 250
RCLMTHNKGV SFSLAASIDA SPALCAPSTG WDMPWILMLL LTMGQGVVIL
260 270 280 290
ALSIVLWRQR VRGAPGRDAS IPQFKPEIQV YENIHLARLG PPAHKPR
Length:297
Mass (Da):32,465
Last modified:February 26, 2008 - v2
Checksum:iB4FFB401D70AA308
GO
Isoform 2 (identifier: Q5SQ64-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     268-297: DASIPQFKPEIQVYENIHLARLGPPAHKPR → GNRMRCYNCG...TCLLPGLWSG

Show »
Length:382
Mass (Da):40,892
Checksum:i6BE11E91E760C8CF
GO

Sequence cautioni

The sequence AAD18078.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence BAB63382.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti34 – 341P → Q.
Corresponds to variant rs17200983 [ dbSNP | Ensembl ].
VAR_038908
Natural varianti39 – 391P → S.1 Publication
Corresponds to variant rs805295 [ dbSNP | Ensembl ].
VAR_038909
Natural varianti107 – 1071A → T.1 Publication
Corresponds to variant rs9267547 [ dbSNP | Ensembl ].
VAR_038910
Natural varianti167 – 1671R → K.
Corresponds to variant rs2242653 [ dbSNP | Ensembl ].
VAR_038911

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei268 – 29730DASIP…AHKPR → GNRMRCYNCGGSPSSSCKEA VTTCGEGRPQPGLEQIKLPG NPPVTLIHQHPACVAAHHCN QVETESVGDVTYPAHRDCYL GDLCNSAVASHVAPAGILAA AATALTCLLPGLWSG in isoform 2. 1 PublicationVSP_055597Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ496460 mRNA. Translation: CAD42968.1.
AF129756 Genomic DNA. Translation: AAD18078.1. Sequence problems.
BA000025 Genomic DNA. Translation: BAB63382.1. Sequence problems.
AF195764 mRNA. Translation: AAF35181.1.
AL670886 Genomic DNA. Translation: CAI17809.1.
AL662899 Genomic DNA. Translation: CAI18402.1.
AL805934 Genomic DNA. Translation: CAI18532.1.
BX248244 Genomic DNA. Translation: CAM26085.1.
CR753842 Genomic DNA. Translation: CAQ06581.1.
CR354443 Genomic DNA. Translation: CAQ07010.1.
CR759787 Genomic DNA. Translation: CAQ10098.1.
CH471081 Genomic DNA. Translation: EAX03485.1.
CH471081 Genomic DNA. Translation: EAX03487.1.
BC137212 mRNA. Translation: AAI37213.1.
BC137213 mRNA. Translation: AAI37214.1.
CCDSiCCDS34403.1. [Q5SQ64-1]
RefSeqiNP_001003693.1. NM_001003693.1. [Q5SQ64-1]
UniGeneiHs.591794.

Genome annotation databases

EnsembliENST00000375832; ENSP00000364992; ENSG00000204424. [Q5SQ64-1]
ENST00000383420; ENSP00000372912; ENSG00000243804.
ENST00000442105; ENSP00000404621; ENSG00000241822.
ENST00000446062; ENSP00000404884; ENSG00000239741. [Q5SQ64-1]
ENST00000447811; ENSP00000409959; ENSG00000240008. [Q5SQ64-1]
ENST00000453044; ENSP00000389102; ENSG00000240957. [Q5SQ64-1]
ENST00000455632; ENSP00000407535; ENSG00000243003. [Q5SQ64-1]
GeneIDi259215.
KEGGihsa:259215.
UCSCiuc003nwa.2. human. [Q5SQ64-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ496460 mRNA. Translation: CAD42968.1.
AF129756 Genomic DNA. Translation: AAD18078.1. Sequence problems.
BA000025 Genomic DNA. Translation: BAB63382.1. Sequence problems.
AF195764 mRNA. Translation: AAF35181.1.
AL670886 Genomic DNA. Translation: CAI17809.1.
AL662899 Genomic DNA. Translation: CAI18402.1.
AL805934 Genomic DNA. Translation: CAI18532.1.
BX248244 Genomic DNA. Translation: CAM26085.1.
CR753842 Genomic DNA. Translation: CAQ06581.1.
CR354443 Genomic DNA. Translation: CAQ07010.1.
CR759787 Genomic DNA. Translation: CAQ10098.1.
CH471081 Genomic DNA. Translation: EAX03485.1.
CH471081 Genomic DNA. Translation: EAX03487.1.
BC137212 mRNA. Translation: AAI37213.1.
BC137213 mRNA. Translation: AAI37214.1.
CCDSiCCDS34403.1. [Q5SQ64-1]
RefSeqiNP_001003693.1. NM_001003693.1. [Q5SQ64-1]
UniGeneiHs.591794.

3D structure databases

ProteinModelPortaliQ5SQ64.
SMRiQ5SQ64. Positions 21-165.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129225. 2 interactions.
IntActiQ5SQ64. 2 interactions.
MINTiMINT-8020134.
STRINGi9606.ENSP00000364992.

PTM databases

iPTMnetiQ5SQ64.

Polymorphism and mutation databases

BioMutaiLY6G6F.
DMDMi172045922.

Proteomic databases

PaxDbiQ5SQ64.
PRIDEiQ5SQ64.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375832; ENSP00000364992; ENSG00000204424. [Q5SQ64-1]
ENST00000383420; ENSP00000372912; ENSG00000243804.
ENST00000442105; ENSP00000404621; ENSG00000241822.
ENST00000446062; ENSP00000404884; ENSG00000239741. [Q5SQ64-1]
ENST00000447811; ENSP00000409959; ENSG00000240008. [Q5SQ64-1]
ENST00000453044; ENSP00000389102; ENSG00000240957. [Q5SQ64-1]
ENST00000455632; ENSP00000407535; ENSG00000243003. [Q5SQ64-1]
GeneIDi259215.
KEGGihsa:259215.
UCSCiuc003nwa.2. human. [Q5SQ64-1]

Organism-specific databases

CTDi259215.
GeneCardsiLY6G6F.
HGNCiHGNC:13933. LY6G6F.
HPAiHPA008053.
MIMi611404. gene.
neXtProtiNX_Q5SQ64.
PharmGKBiPA38371.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJZB. Eukaryota.
ENOG41116W2. LUCA.
GeneTreeiENSGT00390000015960.
HOGENOMiHOG000043066.
HOVERGENiHBG053329.
InParanoidiQ5SQ64.
OMAiASACITA.
OrthoDBiEOG7FJH19.
PhylomeDBiQ5SQ64.
TreeFamiTF337100.

Miscellaneous databases

GenomeRNAii259215.
NextBioi35541920.
PROiQ5SQ64.
SOURCEiSearch...

Gene expression databases

BgeeiQ5SQ64.
CleanExiHS_LY6G6D.
HS_LY6G6F.
GenevisibleiQ5SQ64. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR026524. LY6G6d/LY6G6f.
[Graphical view]
PANTHERiPTHR32286. PTHR32286. 1 hit.
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Adaptor signalling proteins Grb2 and Grb7 are recruited by human G6f, a novel member of the immunoglobulin superfamily encoded in the MHC."
    De Vet E.C.J.M., Aguado B., Campbell R.D.
    Biochem. J. 375:207-213(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH GRB2 AND GRB7, SUBCELLULAR LOCATION, GLYCOSYLATION, PHOSPHORYLATION AT TYR-281, MUTAGENESIS OF TYR-281.
  2. "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse."
    Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L.
    Genome Res. 13:2621-2636(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT SER-39.
  3. "Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region."
    Shiina S., Tamiya G., Oka A., Inoko H.
    Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Identification of MEGT1, a novel megakaryocyte-specific gene."
    Mueller R., Ziegler B.L.
    Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  5. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-107.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  8. "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach."
    Lewandrowski U., Moebius J., Walter U., Sickmann A.
    Mol. Cell. Proteomics 5:226-233(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-88.
    Tissue: Platelet.

Entry informationi

Entry nameiLY66F_HUMAN
AccessioniPrimary (citable) accession number: Q5SQ64
Secondary accession number(s): B0UXB7
, O95869, Q7Z5H2, Q96QC7, Q9NZJ1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: March 16, 2016
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.