Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glutathione S-transferase C-terminal domain-containing protein

Gene

Gstcd

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Glutathione S-transferase C-terminal domain-containing protein
Gene namesi
Name:Gstcd
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:1914803. Gstcd.

Subcellular locationi

  • Cytoplasm By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003169541 – 634Glutathione S-transferase C-terminal domain-containing proteinAdd BLAST634

Proteomic databases

PaxDbiQ5RL51.
PeptideAtlasiQ5RL51.
PRIDEiQ5RL51.

PTM databases

PhosphoSitePlusiQ5RL51.

Expressioni

Gene expression databases

BgeeiENSMUSG00000028018.
GenevisibleiQ5RL51. MM.

Interactioni

Protein-protein interaction databases

IntActiQ5RL51. 1 interactor.
MINTiMINT-217630.
STRINGi10090.ENSMUSP00000029651.

Structurei

3D structure databases

ProteinModelPortaliQ5RL51.
SMRiQ5RL51.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini131 – 333GST C-terminalAdd BLAST203

Sequence similaritiesi

Belongs to the GSTCD family.Curated
Contains 1 GST C-terminal domain.Curated

Phylogenomic databases

eggNOGiENOG410IDXE. Eukaryota.
ENOG410ZVJE. LUCA.
GeneTreeiENSGT00390000004446.
HOVERGENiHBG107970.
InParanoidiQ5RL51.
OMAiPRNRIYT.
OrthoDBiEOG091G098R.
PhylomeDBiQ5RL51.
TreeFamiTF324238.

Family and domain databases

Gene3Di1.20.1050.10. 1 hit.
3.40.50.150. 1 hit.
InterProiIPR010987. Glutathione-S-Trfase_C-like.
IPR004046. GST_C.
IPR025714. Methyltranfer_dom.
IPR029063. SAM-dependent_MTases.
[Graphical view]
PfamiPF14497. GST_C_3. 1 hit.
PF13679. Methyltransf_32. 1 hit.
[Graphical view]
SUPFAMiSSF47616. SSF47616. 1 hit.
SSF53335. SSF53335. 1 hit.
PROSITEiPS50405. GST_CTER. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5RL51-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKGIKKSPTE ESLYLEYSHQ TEGCIFPLHT SVTLFLLSYC ECKVFNVCLV
60 70 80 90 100
LTEESTDTSD TSFLKEALPQ DLEIQVISKQ ALPPIVQNCC LPAVVDQPDV
110 120 130 140 150
FCRAGLAVVL RHIIQKSYEA EPSRKEILEL LGFKKTCLKA CAEVSQWTRL
160 170 180 190 200
CELTIPLAVE NFLQESSEHP PTIPEEILEL ERKLSEPVRV HNDDKLRRQK
210 220 230 240 250
LKQQKAAGSE PPSGKGKAKS KASAQKTPKD LAAPSKSLEL KVAFSKLTVQ
260 270 280 290 300
EDAAASNREP SHIRKAKAAD LPPLEHVFAE GLYFTLADIV LLPCIHHFLV
310 320 330 340 350
IICKKFSEKL EQFPLLTSWY QRIQEVPKVK TAASKCGIYF LYLPELLNSA
360 370 380 390 400
RKQPVNSDEV AAVDEQSDPL FIGGPRPTMT KLMEKGIEAM FSPHPCPAWT
410 420 430 440 450
LDWSSLPAAV SPKEGKMSTD RALRKQQQLN NLVYLVLNQA KPGDRIVDFC
460 470 480 490 500
SGGGHVGIVL AHMLPSCQVT LIENKELSLI RAKKRSDELG LSNIWFIQAN
510 520 530 540 550
MEYFTGMFNI GVALHACGVA TDMVIEHCIQ TRASFITCPC CYGFIQNTSK
560 570 580 590 600
FNFPKSEKFK KTLSYKEHML LCRFADQTAV QLPPERRLIG KQCMGLVDLD
610 620 630
RAAAAGEHGY SVQVISMEPE SCSPKNNMIV GVPL
Length:634
Mass (Da):70,618
Last modified:December 21, 2004 - v1
Checksum:iA895253353135EE8
GO
Isoform 2 (identifier: Q5RL51-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     512-542: VALHACGVATDMVIEHCIQTRASFITCPCCY → PNRPTTDVQCRDDKMFERAVMCDTVLTFSPH
     543-634: Missing.

Show »
Length:542
Mass (Da):60,617
Checksum:i7A17C6478393FC49
GO
Isoform 3 (identifier: Q5RL51-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-378: Missing.

Show »
Length:256
Mass (Da):28,416
Checksum:i83D6F940F3195121
GO
Isoform 4 (identifier: Q5RL51-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     301-330: IICKKFSEKLEQFPLLTSWYQRIQEVPKVK → RMCLQSSCYYAFQFDKLLGFVFGSQQISCL
     331-634: Missing.

Show »
Length:330
Mass (Da):36,862
Checksum:i0132E96F9DB16212
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti198R → I in AAH61240 (PubMed:15489334).Curated1
Sequence conflicti414E → G in BAB29091 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0308231 – 378Missing in isoform 3. 1 PublicationAdd BLAST378
Alternative sequenceiVSP_030824301 – 330IICKK…VPKVK → RMCLQSSCYYAFQFDKLLGF VFGSQQISCL in isoform 4. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_030825331 – 634Missing in isoform 4. 1 PublicationAdd BLAST304
Alternative sequenceiVSP_030826512 – 542VALHA…CPCCY → PNRPTTDVQCRDDKMFERAV MCDTVLTFSPH in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_030827543 – 634Missing in isoform 2. 1 PublicationAdd BLAST92

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK037169 mRNA. Translation: BAC29731.1.
AK013967 mRNA. Translation: BAB29091.1.
AK017059 mRNA. Translation: BAB30574.2.
AK020021 mRNA. Translation: BAB31969.1.
AK044441 mRNA. Translation: BAC31921.1.
BC047136 mRNA. Translation: AAH47136.1.
BC061240 mRNA. Translation: AAH61240.1.
CCDSiCCDS17847.1. [Q5RL51-1]
RefSeqiNP_080507.2. NM_026231.2. [Q5RL51-1]
XP_006502001.1. XM_006501938.3. [Q5RL51-2]
UniGeneiMm.304899.

Genome annotation databases

EnsembliENSMUST00000029651; ENSMUSP00000029651; ENSMUSG00000028018. [Q5RL51-1]
ENSMUST00000080583; ENSMUSP00000079421; ENSMUSG00000028018. [Q5RL51-1]
GeneIDi67553.
KEGGimmu:67553.
UCSCiuc008rkg.1. mouse. [Q5RL51-1]
uc008rki.1. mouse. [Q5RL51-4]
uc012cxx.1. mouse. [Q5RL51-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK037169 mRNA. Translation: BAC29731.1.
AK013967 mRNA. Translation: BAB29091.1.
AK017059 mRNA. Translation: BAB30574.2.
AK020021 mRNA. Translation: BAB31969.1.
AK044441 mRNA. Translation: BAC31921.1.
BC047136 mRNA. Translation: AAH47136.1.
BC061240 mRNA. Translation: AAH61240.1.
CCDSiCCDS17847.1. [Q5RL51-1]
RefSeqiNP_080507.2. NM_026231.2. [Q5RL51-1]
XP_006502001.1. XM_006501938.3. [Q5RL51-2]
UniGeneiMm.304899.

3D structure databases

ProteinModelPortaliQ5RL51.
SMRiQ5RL51.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ5RL51. 1 interactor.
MINTiMINT-217630.
STRINGi10090.ENSMUSP00000029651.

PTM databases

PhosphoSitePlusiQ5RL51.

Proteomic databases

PaxDbiQ5RL51.
PeptideAtlasiQ5RL51.
PRIDEiQ5RL51.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000029651; ENSMUSP00000029651; ENSMUSG00000028018. [Q5RL51-1]
ENSMUST00000080583; ENSMUSP00000079421; ENSMUSG00000028018. [Q5RL51-1]
GeneIDi67553.
KEGGimmu:67553.
UCSCiuc008rkg.1. mouse. [Q5RL51-1]
uc008rki.1. mouse. [Q5RL51-4]
uc012cxx.1. mouse. [Q5RL51-2]

Organism-specific databases

CTDi79807.
MGIiMGI:1914803. Gstcd.

Phylogenomic databases

eggNOGiENOG410IDXE. Eukaryota.
ENOG410ZVJE. LUCA.
GeneTreeiENSGT00390000004446.
HOVERGENiHBG107970.
InParanoidiQ5RL51.
OMAiPRNRIYT.
OrthoDBiEOG091G098R.
PhylomeDBiQ5RL51.
TreeFamiTF324238.

Miscellaneous databases

ChiTaRSiGstcd. mouse.
PROiQ5RL51.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028018.
GenevisibleiQ5RL51. MM.

Family and domain databases

Gene3Di1.20.1050.10. 1 hit.
3.40.50.150. 1 hit.
InterProiIPR010987. Glutathione-S-Trfase_C-like.
IPR004046. GST_C.
IPR025714. Methyltranfer_dom.
IPR029063. SAM-dependent_MTases.
[Graphical view]
PfamiPF14497. GST_C_3. 1 hit.
PF13679. Methyltransf_32. 1 hit.
[Graphical view]
SUPFAMiSSF47616. SSF47616. 1 hit.
SSF53335. SSF53335. 1 hit.
PROSITEiPS50405. GST_CTER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGSTCD_MOUSE
AccessioniPrimary (citable) accession number: Q5RL51
Secondary accession number(s): Q6P8I1
, Q8BXR2, Q8BYY6, Q9CTV2, Q9CUA9, Q9CXU7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: December 21, 2004
Last modified: November 2, 2016
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.