Q5RJI5 (BRSK1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein kinase BRSK1 EC=2.7.11.1 EC=2.7.11.26 Alternative name(s): Brain-specific serine/threonine-protein kinase 1 Short name=BR serine/threonine-protein kinase 1 Serine/threonine-protein kinase SAD-B | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 778 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine-protein kinase that plays a key role in polarization of neurons and centrosome duplication. Phosphorylates CDC25B, CDC25C, MAPT/TAU, RIMS1, TUBG1, TUBG2 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a key regulator of polarization of cortical neurons, probably by mediating phosphorylation of microtubule-associated proteins such as MAPT/TAU at 'Ser-554'. Also regulates neuron polarization by mediating phosphorylation of WEE1 at 'Ser-642' in post-mitotic neurons, leading to down-regulate WEE1 activity in polarized neurons. In neurons, localizes to synaptic vesicles and plays a role in neurotransmitter release, possibly by phosphorylating RIMS1. Also acts as a positive regulator of centrosome duplication by mediating phosphorylation of gamma-tubulin (TUBG1 and TUBG2) at 'Ser-131', leading to translocation of gamma-tubulin and its associated proteins to the centrosome. Involved in the UV-induced DNA damage checkpoint response, probably by inhibiting CDK1 activity through phosphorylation and activation of WEE1, and inhibition of CDC25B and CDC25C. Ref.1 Ref.2 Ref.4 Ref.5 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. ATP + [tau protein] = ADP + [tau protein] phosphate. |
| Cofactor | Magnesium By similarity. |
| Enzyme regulation | Activated by phosphorylation on Thr-189 by STK11/LKB1. Ref.4 |
| Subcellular location | Cytoplasm By similarity. Nucleus By similarity. Cytoplasm › cytoskeleton › centrosome By similarity. Cell junction › synapse By similarity. Note: Nuclear in the absence of DNA damage. Translocated to the nucleus in response to UV- or MMS-induced DNA damage. Localizes to synaptic vesicles in neurons By similarity. Ref.2 |
| Tissue specificity | Present in the gray matter of the brain and spinal cord (at protein level). Expressed in the nervous system, distributed within the brain and spinal cord of embryonic and postnatal animals. Ref.1 |
| Developmental stage | Activity is high in G0, decreases after serum addition, and increases transiently in advanced G1, at G1-S, and in S phases. Ref.2 |
| Post-translational modification | Phosphorylated at Thr-189 by STK11/LKB1 in complex with STE20-related adapter-alpha (STRADA) pseudo kinase and CAB39. Not phosphorylated at Thr-189 by CaMKK2. In contrast, it is phosphorylated and activated by CaMKK1. May be inactivated via dephosphorylation of Thr-189 by PP2C. Ref.4 |
| Disruption phenotype | No visible phenotype. Mice are fertile and healthy. In contrast, mice lacking both Brsk1 and Brsk2 show little spontaneous movement and are only weakly responsive to tactile stimulation: they die within 2 hours of birth. Defects are due to distordal neuronal polarity. Ref.1 |
| Sequence similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily. Contains 1 protein kinase domain. Contains 1 UBA domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5RJI5-1) Also known as: SADB-Long; L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5RJI5-2) Also known as: SADB-short; S; The sequence of this isoform differs from the canonical sequence as follows: 344-778: Missing. | ||||||
| Isoform 3 (identifier: Q5RJI5-3) The sequence of this isoform differs from the canonical sequence as follows: 18-19: Missing. 344-778: Missing. | ||||||
| Isoform 4 (identifier: Q5RJI5-4) Also known as: SADB-short 1; S1; The sequence of this isoform differs from the canonical sequence as follows: 1-45: MSSGSKEGGGGSPAYHLPHPHPHPPQHAQYVGPYRLEKTLGKGQT → MQKFGIEEM 344-778: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 778 | 778 | Serine/threonine-protein kinase BRSK1 | PRO_0000260829 | |||||
Regions | |||||||||
| Domain | 34 – 285 | 252 | Protein kinase | ||||||
| Domain | 314 – 356 | 43 | UBA | ||||||
| Nucleotide binding | 40 – 48 | 9 | ATP By similarity | ||||||
| Compositional bias | 492 – 540 | 49 | Pro-rich | ||||||
Sites | |||||||||
| Active site | 156 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 63 | 1 | ATP Probable | ||||||
Amino acid modifications | |||||||||
| Modified residue | 189 | 1 | Phosphothreonine; by LKB1 Ref.4 | ||||||
| Modified residue | 193 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 447 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 508 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 563 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 45 | 45 | MSSGS…GKGQT → MQKFGIEEM in isoform 4. | VSP_041743 | |||||
| Alternative sequence | 18 – 19 | 2 | Missing in isoform 3. | VSP_041744 | |||||
| Alternative sequence | 344 – 778 | 435 | Missing in isoform 2, isoform 3 and isoform 4. | VSP_041745 | |||||
Experimental info | |||||||||
| Mutagenesis | 63 | 1 | K → R: Abolishes kinase activity and ability to regulate centrosome duplication. Ref.2 | ||||||
| Mutagenesis | 189 | 1 | T → A: Abolishes activation by STK11/LKB1. Ref.4 | ||||||
| Sequence conflict | 23 – 24 | 2 | Missing in AAT08446. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mammalian SAD kinases are required for neuronal polarization." Kishi M., Pan Y.A., Crump J.G., Sanes J.R. Science 307:929-932(2005) [PubMed: 15705853] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. |
| [2] | "SADB phosphorylation of gamma-tubulin regulates centrosome duplication." Alvarado-Kristensson M., Rodriguez M.J., Silio V., Valpuesta J.M., Carrera A.C. Nat. Cell Biol. 11:1081-1092(2009) [PubMed: 19648910] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-63, DEVELOPMENTAL STAGE. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Strain: C57BL/6. |
| [4] | "LKB1 and SAD kinases define a pathway required for the polarization of cortical neurons." Barnes A.P., Lilley B.N., Pan Y.A., Plummer L.J., Powell A.W., Raines A.N., Sanes J.R., Polleux F. Cell 129:549-563(2007) [PubMed: 17482548] [Abstract] Cited for: FUNCTION, ENZYME REGULATION, PHOSPHORYLATION AT THR-189, MUTAGENESIS OF THR-189. |
| [5] | "Persistence of the cell-cycle checkpoint kinase Wee1 in SadA- and SadB-deficient neurons disrupts neuronal polarity." Muller M., Lutter D., Puschel A.W. J. Cell Sci. 123:286-294(2010) [PubMed: 20026642] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY533671 mRNA. Translation: AAT08446.1. EU586326 mRNA. Translation: ACE82255.1. EU016556 mRNA. Translation: ABS57358.1. EU016557 mRNA. Translation: ABS57359.1. EU016558 mRNA. Translation: ABS57360.1. BC086636 mRNA. Translation: AAH86636.1. |
| IPI | IPI00515701. IPI00955067. IPI01027424. IPI01027582. |
| RefSeq | NP_001003920.2. NM_001003920.3. NP_001162044.1. NM_001168572.1. |
| UniGene | Mm.297064. |
3D structure databases | |
| HSSP | HSSP built from PDB template 2EUE based on UniProtKB P06782. |
| ProteinModelPortal | Q5RJI5. |
| SMR | Q5RJI5. Positions 27-290. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5RJI5. 2 interactions. |
| STRING | Q5RJI5. |
PTM databases | |
| PhosphoSite | Q5RJI5. |
Proteomic databases | |
| PRIDE | Q5RJI5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000048248; ENSMUSP00000039517; ENSMUSG00000035390. ENSMUST00000170011; ENSMUSP00000127743; ENSMUSG00000035390. |
| GeneID | 381979. |
| KEGG | mmu:381979. |
| UCSC | uc009eyf.1. mouse. |
Organism-specific databases | |
| CTD | 84446. |
| MGI | MGI:2685946. Brsk1. |
Phylogenomic databases | |
| eggNOG | roNOG10787. |
| GeneTree | ENSGT00570000078909. |
| HOGENOM | HBG715635. |
| HOVERGEN | HBG007240. |
| InParanoid | Q5RJI5. |
| OMA | GPPKDKK. |
| OrthoDB | EOG479F6K. |
| PhylomeDB | Q5RJI5. |
Gene expression databases | |
| ArrayExpress | Q5RJI5. |
| Bgee | Q5RJI5. |
| CleanEx | MM_BRSK1. |
| Genevestigator | Q5RJI5. |
| GermOnline | ENSMUSG00000035390. Mus musculus. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_kinase-like_dom. IPR008271. Ser/Thr_kinase_AS. IPR002290. Ser/Thr_kinase_dom. IPR015940. UBA/transl_elong_EF1B_N_euk. [Graphical view] |
| KO | K08796. |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. PS50030. UBA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 402808. |
| SOURCE | Search... |
Entry information
| Entry name | BRSK1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q5RJI5 Secondary accession number(s): A7LH90 Q699J6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with