Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lysosome-associated membrane glycoprotein 5

Gene

LAMP5

Organism
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain.By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Lysosome-associated membrane glycoprotein 5
Alternative name(s):
Brain and dendritic cell-associated LAMP
Brain-associated LAMP-like protein
Short name:
BAD-LAMP
Lysosome-associated membrane protein 5
Short name:
LAMP-5
Gene namesi
Name:LAMP5
OrganismiPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Taxonomic identifieri9601 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaePongo
Proteomesi
  • UP000001595 Componenti: Chromosome 20

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini30 – 234ExtracellularCuratedAdd BLAST205
Transmembranei235 – 255HelicalSequence analysisAdd BLAST21
Topological domaini256 – 261CytoplasmicCurated6

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasmic vesicle, Endosome, Membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_000004264330 – 261Lysosome-associated membrane glycoprotein 5Add BLAST232

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi35N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi53N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi126N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1

Post-translational modificationi

Glycosylated.By similarity

Keywords - PTMi

Glycoprotein

Family & Domainsi

Sequence similaritiesi

Belongs to the LAMP family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IE1D Eukaryota
ENOG410YUG5 LUCA
GeneTreeiENSGT00390000012584
HOVERGENiHBG051186
InParanoidiQ5R5V2
OMAiIYHIHHK

Family and domain databases

InterProiView protein in InterPro
IPR002000 Lysosome-assoc_membr_glycop
PANTHERiPTHR11506 PTHR11506, 1 hit
PfamiView protein in Pfam
PF01299 Lamp, 1 hit
PROSITEiView protein in PROSITE
PS00310 LAMP_1, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5R5V2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLQGRAVPS VDRLRVLLML FHTMAQIMAE QEVENLSGLS TNPEKDIFVV
60 70 80 90 100
RENGTTCLMA EFAAKFIVPY DVWASNYVDL ITEQADIALT RGAEVGRCGH
110 120 130 140 150
SESELQVFWV DRAYALKMLF VKESHNMSKG PEETWRLSKV QFVYDSSEKT
160 170 180 190 200
HFKDAVSAGK HTANSHHLSA LVTPAGKSYE CQAQQTISLA SSDPQKTVTM
210 220 230 240 250
ILSAVHIQPF DIISDFVFSE EHKCAVDERE QLEETLPLIL GLILGLVIVV
260
TLAIYHVHPQ K
Length:261
Mass (Da):29,190
Last modified:October 25, 2017 - v2
Checksum:iE4E1B6E99648AB6A
GO
Isoform 2 (identifier: Q5R5V2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     221-261: EHKCAVDEREQLEETLPLILGLILGLVIVVTLAIYHVHPQK → GN

Show »
Length:222
Mass (Da):24,748
Checksum:i3FB01706284A9A7D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti95V → VK in ABGA01004038 (Ref. 2) Curated1
Sequence conflicti95V → VK in ABGA01004039 (Ref. 2) Curated1
Sequence conflicti197T → I in ABGA01004038 (Ref. 2) Curated1
Sequence conflicti197T → I in ABGA01004039 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_059121221 – 261EHKCA…VHPQK → GN in isoform 2. Add BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR860751 mRNA Translation: CAH92864.1
ABGA01004038 Genomic DNA No translation available.
ABGA01004039 Genomic DNA No translation available.
RefSeqiNP_001126676.1, NM_001133204.1
UniGeneiPab.2703

Genome annotation databases

EnsembliENSPPYT00000012435; ENSPPYP00000011964; ENSPPYG00000010702 [Q5R5V2-1]
GeneIDi100173676
KEGGipon:100173676

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLAMP5_PONAB
AccessioniPrimary (citable) accession number: Q5R5V2
Secondary accession number(s): H2P108
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: October 25, 2017
Last modified: March 28, 2018
This is version 47 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health