Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rab GTPase-activating protein 1-like

Gene

RABGAP1L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei580Arginine fingerBy similarity1
Sitei621Glutamine fingerBy similarity1

GO - Molecular functioni

  • GTPase activator activity Source: MGI
  • Rab GTPase binding Source: BHF-UCL

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Names & Taxonomyi

Protein namesi
Recommended name:
Rab GTPase-activating protein 1-like
Gene namesi
Name:RABGAP1LImported
Synonyms:HHLImported, KIAA0471Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:24663. RABGAP1L.

Subcellular locationi

GO - Cellular componenti

  • early endosome Source: MGI
  • Golgi apparatus Source: MGI
  • nucleus Source: MGI
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi9910.
OpenTargetsiENSG00000152061.
PharmGKBiPA134940645.

Polymorphism and mutation databases

BioMutaiMLIP.
DMDMi205829393.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003480541 – 815Rab GTPase-activating protein 1-likeAdd BLAST815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei471PhosphothreonineCombined sources1
Modified residuei480PhosphoserineCombined sources1
Modified residuei490PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ5R372.
PaxDbiQ5R372.
PeptideAtlasiQ5R372.
PRIDEiQ5R372.

PTM databases

iPTMnetiQ5R372.
PhosphoSitePlusiQ5R372.

Expressioni

Inductioni

Up-regulated in esophageal squamous cell carcinomas. Expression is strongly inhibited in the medial septum and hippocampus brain regions of some Alzheimer disease patients.2 Publications

Gene expression databases

BgeeiENSG00000152061.
ExpressionAtlasiQ5R372. baseline and differential.
GenevisibleiQ5R372. HS.

Organism-specific databases

HPAiHPA054695.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
C9orf43Q8TAL53EBI-10692254,EBI-10694291
MECOMQ134653EBI-10692254,EBI-8475192

GO - Molecular functioni

  • Rab GTPase binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi115239. 42 interactors.
IntActiQ5R372. 22 interactors.
STRINGi9606.ENSP00000251507.

Structurei

Secondary structure

1815
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi513 – 521Combined sources9
Helixi531 – 537Combined sources7
Helixi541 – 543Combined sources3
Helixi544 – 551Combined sources8
Helixi558 – 567Combined sources10
Helixi575 – 582Combined sources8
Turni590 – 592Combined sources3
Helixi598 – 613Combined sources16
Turni615 – 617Combined sources3
Helixi623 – 633Combined sources11
Helixi636 – 648Combined sources13
Helixi652 – 655Combined sources4
Helixi657 – 677Combined sources21
Helixi679 – 688Combined sources10
Helixi692 – 694Combined sources3
Helixi697 – 702Combined sources6
Turni703 – 707Combined sources5
Helixi710 – 723Combined sources14
Helixi727 – 738Combined sources12
Helixi740 – 744Combined sources5
Helixi748 – 756Combined sources9
Helixi758 – 761Combined sources4
Helixi766 – 778Combined sources13
Helixi783 – 796Combined sources14

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3HZJX-ray2.30A/B/C507-815[»]
ProteinModelPortaliQ5R372.
SMRiQ5R372.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ5R372.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini126 – 282PIDPROSITE-ProRule annotationAdd BLAST157
Domaini538 – 724Rab-GAP TBCPROSITE-ProRule annotationAdd BLAST187

Domaini

The arginine and glutamine fingers are critical for the GTPase-activating mechanism, they pull out Rab's 'switch 2' glutamine and insert in Rab's active site.By similarity

Sequence similaritiesi

Contains 1 PID domain.PROSITE-ProRule annotation
Contains 1 Rab-GAP TBC domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1102. Eukaryota.
COG5210. LUCA.
GeneTreeiENSGT00750000117238.
HOVERGENiHBG063892.
InParanoidiQ5R372.
OMAiDTEGDGQ.
OrthoDBiEOG091G0AIH.
PhylomeDBiQ5R372.
TreeFamiTF317184.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR022164. Kinesin-like.
IPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
IPR000195. Rab-GTPase-TBC_dom.
[Graphical view]
PfamiPF12473. DUF3694. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view]
SUPFAMiSSF47923. SSF47923. 2 hits.
SSF50729. SSF50729. 1 hit.
PROSITEiPS01179. PID. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 12 Publications (identifier: Q5R372-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEVRASLQKV SGSSDSVATM NSEEFVLVPQ YADDNSTKHE EKPQLKIVSN
60 70 80 90 100
GDEQLEKAME EILRDSEKRP SSLLVDCQSS SEISDHSFGD IPASQTNKPS
110 120 130 140 150
LQLILDPSNT EISTPRPSSP GGLPEEDSVL FNKLTYLGCM KVSSPRNEVE
160 170 180 190 200
ALRAMATMKS SSQYPFPVTL YVPNVPEGSV RIIDQSSNVE IASFPIYKVL
210 220 230 240 250
FCARGHDGTT ESNCFAFTES SHGSEEFQIH VFSCEIKEAV SRILYSFCTA
260 270 280 290 300
FKRSSRQVSD VKDSVIPTPD SDVFTFSVSL EVKEDDGKGN FSPVPKDRDK
310 320 330 340 350
FYFKLKQGIE KKVVITVQQL SNKELAIERC FGMLLSPGRN VKNSDMHLLD
360 370 380 390 400
MESMGKSYDG RAYVITGMWN PNAPVFLALN EETPKDKQVY MTVAVDMVVT
410 420 430 440 450
EVVEPVRFLL ETVVRVYPAN ERFWYFSRKT FTETFFMRLK QSEGKGHTNA
460 470 480 490 500
GDAIYEVVSL QRESDKEEPV TPTSGGGPMS PQDDEAEEES DNELSSGTGD
510 520 530 540 550
VSKDCPEKIL YSWGELLGKW HSNLGARPKG LSTLVKSGVP EALRAEVWQL
560 570 580 590 600
LAGCHDNQAM LDRYRILITK DSAQESVITR DIHRTFPAHD YFKDTGGDGQ
610 620 630 640 650
ESLYKICKAY SVYDEDIGYC QGQSFLAAVL LLHMPEEQAF CVLVKIMYDY
660 670 680 690 700
GLRDLYRNNF EDLHCKFYQL ERLMQEQLPD LHSHFSDLNL EAHMYASQWF
710 720 730 740 750
LTLFTAKFPL CMVFHIIDLL LCEGLNIIFH VALALLKTSK EDLLQADFEG
760 770 780 790 800
ALKFFRVQLP KRYRAEENAR RLMEQACNIK VPTKKLKKYE KEYQTMRESQ
810
LQQEDPMDRY KFVYL
Length:815
Mass (Da):92,513
Last modified:February 5, 2008 - v1
Checksum:i6928AEB23DDD0D3E
GO
Isoform 22 Publications (identifier: Q5R372-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-46: Missing.
     571-642: DSAQESVITR...HMPEEQAFCV → QQMKFSLTPR...HQLIKRLNAC
     643-815: Missing.

Show »
Length:605
Mass (Da):68,003
Checksum:i27D108AFBD84ECAE
GO
Isoform 31 Publication (identifier: Q5R372-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-291: F → FRLLVIPIPFEYF

Show »
Length:827
Mass (Da):94,002
Checksum:i582761A7A13A7536
GO
Isoform 41 Publication (identifier: Q5R372-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     478-492: Missing.

Show »
Length:800
Mass (Da):90,838
Checksum:iC9187DB88D4ADBAC
GO
Isoform 52 Publications (identifier: Q5R372-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-673: Missing.
     675-675: Q → K
     812-815: FVYL → RENRRLQEAS...PVTQPPKEST

Show »
Length:378
Mass (Da):43,888
Checksum:i5549EF6C459572FC
GO
Isoform 62 Publications (identifier: Q5R372-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-673: Missing.
     674-675: MQ → M
     812-815: FVYL → RENRRLQEAS...PVTQPPKEST

Show »
Length:377
Mass (Da):43,760
Checksum:iED96B4D7B41949FB
GO
Isoform 72 Publications (identifier: Q5R372-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-693: Missing.
     812-815: FVYL → RENRRLQEAS...PVTQPPKEST

Show »
Length:358
Mass (Da):41,545
Checksum:iFAAB837F33FB4638
GO
Isoform 82 Publications (identifier: Q5R372-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-681: Missing.
     682-737: HSHFSDLNLE...IFHVALALLK → MEEGVPCPAP...HRLFVPRLLA
     812-815: FVYL → RENRRLQEAS...PVTQPPKEST

Show »
Length:370
Mass (Da):42,689
Checksum:i857D468A7E83B240
GO
Isoform 91 Publication (identifier: Q5R372-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-743: Missing.
     744-780: LQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIK → MMEEISIMVAYDAHVFSQLHDEDFLTSLVAISKPRSM

Show »
Length:72
Mass (Da):8,667
Checksum:iE61821538DEB443B
GO
Isoform 10 (identifier: B7ZAP0-1) [UniParc]FASTAAdd to basket
Also known as: D
The sequence of this isoform can be found in the external entry B7ZAP0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:253
Mass (Da):29,038
GO

Sequence cautioni

The sequence BAA32316 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti311K → R in BAC04635 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_052533277S → G.Corresponds to variant rs7339904dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0529121 – 743Missing in isoform 9. 2 PublicationsAdd BLAST743
Alternative sequenceiVSP_0529131 – 693Missing in isoform 7. 2 PublicationsAdd BLAST693
Alternative sequenceiVSP_0529141 – 681Missing in isoform 8. 2 PublicationsAdd BLAST681
Alternative sequenceiVSP_0529151 – 673Missing in isoform 5 and isoform 6. 2 PublicationsAdd BLAST673
Alternative sequenceiVSP_05291610 – 46Missing in isoform 2. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_052917291F → FRLLVIPIPFEYF in isoform 3. 2 Publications1
Alternative sequenceiVSP_052918478 – 492Missing in isoform 4. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_052919571 – 642DSAQE…QAFCV → QQMKFSLTPRQTIHLVKYEG SMKVSMTPCNQLQFDIRLDV LITYTFCFSSFPEPELYKYV LKHQLIKRLNAC in isoform 2. 2 PublicationsAdd BLAST72
Alternative sequenceiVSP_052920643 – 815Missing in isoform 2. 2 PublicationsAdd BLAST173
Alternative sequenceiVSP_052921674 – 675MQ → M in isoform 6. 2 Publications2
Alternative sequenceiVSP_035087675Q → K in isoform 5. 1 Publication1
Alternative sequenceiVSP_052922682 – 737HSHFS…LALLK → MEEGVPCPAPAAKLTPPVKK SQDMHDERSKLVNEYACRVL ELLGMGHRLFVPRLLA in isoform 8. 2 PublicationsAdd BLAST56
Alternative sequenceiVSP_052923744 – 780LQADF…ACNIK → MMEEISIMVAYDAHVFSQLH DEDFLTSLVAISKPRSM in isoform 9. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_052924812 – 815FVYL → RENRRLQEASMRLEQENDDL AHELVTSKIALRNDLDQAED KADVLNKELLLTKQRLVETE EEKRKQEEETAQLKEVFRKQ LEKAEYEIKKTTAIIAEYKQ ICSQLSTRLEKQQAASKEEL EVVKGKMMACKHCSDIFSKE GALKLAATGREDQGIETDDE KDSLKKQLREMELELAQTKL QLVEAKCKIQELEHQRGALM NEIQAAKNSWFSKTLNSIKT ATGTQPLQPAPVTQPPKEST in isoform 5, isoform 6, isoform 7 and isoform 8. 3 Publications4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB019489 mRNA. Translation: BAA77330.1.
AB019491 mRNA. Translation: BAA77332.1.
AB019492 mRNA. Translation: BAA77333.2.
AB019493 mRNA. Translation: BAA77334.1.
AB007940 mRNA. Translation: BAA32316.2. Different initiation.
AL049702 mRNA. Translation: CAB41266.1.
AL157958 mRNA. Translation: CAB76100.1.
AK095838 mRNA. Translation: BAC04635.1.
AL021069
, AL022171, AL022400, AL031286 Genomic DNA. Translation: CAI23486.1.
AL022171, AL022400, AL031286 Genomic DNA. Translation: CAI20382.1.
AL022171
, AL021069, AL022400, AL031286 Genomic DNA. Translation: CAI20383.1.
AL022171
, AL022400, AL031286, AL136377, AL161671, AL591108, Z99127 Genomic DNA. Translation: CAI20384.1.
AL022400, AL022171, AL031286 Genomic DNA. Translation: CAI22876.1.
AL022400
, AL021069, AL022171, AL031286 Genomic DNA. Translation: CAI22877.1.
AL022400
, AL022171, AL031286, AL136377, AL161671, AL591108, Z99127 Genomic DNA. Translation: CAI22878.1.
AL031286, AL022171, AL022400 Genomic DNA. Translation: CAI22380.1.
AL031286
, AL021069, AL022171, AL022400 Genomic DNA. Translation: CAI22381.1.
AL031286
, AL022171, AL022400, AL136377, AL161671, AL591108, Z99127 Genomic DNA. Translation: CAI22382.1.
AL136377, AL161671, Z99127 Genomic DNA. Translation: CAI22932.1.
AL136377, AL161671, Z99127 Genomic DNA. Translation: CAI22933.1.
AL136377, AL161671, Z99127 Genomic DNA. Translation: CAI22934.1.
AL136377
, AL022171, AL022400, AL031286, AL161671, AL591108, Z99127 Genomic DNA. Translation: CAI22935.1.
AL161671, Z99127 Genomic DNA. Translation: CAI16277.1.
AL161671, AL136377, Z99127 Genomic DNA. Translation: CAI16278.1.
AL161671, AL136377, Z99127 Genomic DNA. Translation: CAI16279.1.
AL161671, AL136377, Z99127 Genomic DNA. Translation: CAI16280.1.
AL161671
, AL022171, AL022400, AL031286, AL136377, AL591108, Z99127 Genomic DNA. Translation: CAI16281.1.
AL591108
, AL022171, AL022400, AL031286, AL136377, AL161671, Z99127 Genomic DNA. Translation: CAH70225.1.
Z99127, AL161671 Genomic DNA. Translation: CAI18933.1.
Z99127, AL136377, AL161671 Genomic DNA. Translation: CAI18934.1.
Z99127, AL136377, AL161671 Genomic DNA. Translation: CAI18935.1.
Z99127, AL136377, AL161671 Genomic DNA. Translation: CAI18936.1.
Z99127
, AL022171, AL022400, AL031286, AL136377, AL161671, AL591108 Genomic DNA. Translation: CAI18937.1.
CH471067 Genomic DNA. Translation: EAW90977.1.
CH471067 Genomic DNA. Translation: EAW90979.1.
BC012094 mRNA. Translation: AAH12094.1.
BC018630 mRNA. Translation: AAH18630.2.
BC041888 mRNA. Translation: AAH41888.1.
AY364260 mRNA. Translation: AAQ76819.1.
CCDSiCCDS1314.1. [Q5R372-1]
CCDS41437.1. [Q5R372-9]
CCDS58046.1. [Q5R372-8]
RefSeqiNP_001030307.1. NM_001035230.2. [Q5R372-9]
NP_001230692.1. NM_001243763.1. [Q5R372-9]
NP_001230694.1. NM_001243765.1. [Q5R372-8]
NP_055672.3. NM_014857.4. [Q5R372-1]
UniGeneiHs.585378.
Hs.744937.

Genome annotation databases

EnsembliENST00000251507; ENSP00000251507; ENSG00000152061. [Q5R372-1]
ENST00000325589; ENSP00000318603; ENSG00000152061. [Q5R372-7]
ENST00000347255; ENSP00000281844; ENSG00000152061. [Q5R372-5]
ENST00000357444; ENSP00000350027; ENSG00000152061. [Q5R372-2]
ENST00000367687; ENSP00000356660; ENSG00000152061. [Q5R372-6]
ENST00000478442; ENSP00000434600; ENSG00000152061. [Q5R372-9]
ENST00000486220; ENSP00000432490; ENSG00000152061. [Q5R372-9]
ENST00000489615; ENSP00000420660; ENSG00000152061. [Q5R372-8]
GeneIDi9910.
UCSCiuc001gjw.4. human. [Q5R372-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism, Ribosomal frameshifting

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB019489 mRNA. Translation: BAA77330.1.
AB019491 mRNA. Translation: BAA77332.1.
AB019492 mRNA. Translation: BAA77333.2.
AB019493 mRNA. Translation: BAA77334.1.
AB007940 mRNA. Translation: BAA32316.2. Different initiation.
AL049702 mRNA. Translation: CAB41266.1.
AL157958 mRNA. Translation: CAB76100.1.
AK095838 mRNA. Translation: BAC04635.1.
AL021069
, AL022171, AL022400, AL031286 Genomic DNA. Translation: CAI23486.1.
AL022171, AL022400, AL031286 Genomic DNA. Translation: CAI20382.1.
AL022171
, AL021069, AL022400, AL031286 Genomic DNA. Translation: CAI20383.1.
AL022171
, AL022400, AL031286, AL136377, AL161671, AL591108, Z99127 Genomic DNA. Translation: CAI20384.1.
AL022400, AL022171, AL031286 Genomic DNA. Translation: CAI22876.1.
AL022400
, AL021069, AL022171, AL031286 Genomic DNA. Translation: CAI22877.1.
AL022400
, AL022171, AL031286, AL136377, AL161671, AL591108, Z99127 Genomic DNA. Translation: CAI22878.1.
AL031286, AL022171, AL022400 Genomic DNA. Translation: CAI22380.1.
AL031286
, AL021069, AL022171, AL022400 Genomic DNA. Translation: CAI22381.1.
AL031286
, AL022171, AL022400, AL136377, AL161671, AL591108, Z99127 Genomic DNA. Translation: CAI22382.1.
AL136377, AL161671, Z99127 Genomic DNA. Translation: CAI22932.1.
AL136377, AL161671, Z99127 Genomic DNA. Translation: CAI22933.1.
AL136377, AL161671, Z99127 Genomic DNA. Translation: CAI22934.1.
AL136377
, AL022171, AL022400, AL031286, AL161671, AL591108, Z99127 Genomic DNA. Translation: CAI22935.1.
AL161671, Z99127 Genomic DNA. Translation: CAI16277.1.
AL161671, AL136377, Z99127 Genomic DNA. Translation: CAI16278.1.
AL161671, AL136377, Z99127 Genomic DNA. Translation: CAI16279.1.
AL161671, AL136377, Z99127 Genomic DNA. Translation: CAI16280.1.
AL161671
, AL022171, AL022400, AL031286, AL136377, AL591108, Z99127 Genomic DNA. Translation: CAI16281.1.
AL591108
, AL022171, AL022400, AL031286, AL136377, AL161671, Z99127 Genomic DNA. Translation: CAH70225.1.
Z99127, AL161671 Genomic DNA. Translation: CAI18933.1.
Z99127, AL136377, AL161671 Genomic DNA. Translation: CAI18934.1.
Z99127, AL136377, AL161671 Genomic DNA. Translation: CAI18935.1.
Z99127, AL136377, AL161671 Genomic DNA. Translation: CAI18936.1.
Z99127
, AL022171, AL022400, AL031286, AL136377, AL161671, AL591108 Genomic DNA. Translation: CAI18937.1.
CH471067 Genomic DNA. Translation: EAW90977.1.
CH471067 Genomic DNA. Translation: EAW90979.1.
BC012094 mRNA. Translation: AAH12094.1.
BC018630 mRNA. Translation: AAH18630.2.
BC041888 mRNA. Translation: AAH41888.1.
AY364260 mRNA. Translation: AAQ76819.1.
CCDSiCCDS1314.1. [Q5R372-1]
CCDS41437.1. [Q5R372-9]
CCDS58046.1. [Q5R372-8]
RefSeqiNP_001030307.1. NM_001035230.2. [Q5R372-9]
NP_001230692.1. NM_001243763.1. [Q5R372-9]
NP_001230694.1. NM_001243765.1. [Q5R372-8]
NP_055672.3. NM_014857.4. [Q5R372-1]
UniGeneiHs.585378.
Hs.744937.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3HZJX-ray2.30A/B/C507-815[»]
ProteinModelPortaliQ5R372.
SMRiQ5R372.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115239. 42 interactors.
IntActiQ5R372. 22 interactors.
STRINGi9606.ENSP00000251507.

PTM databases

iPTMnetiQ5R372.
PhosphoSitePlusiQ5R372.

Polymorphism and mutation databases

BioMutaiMLIP.
DMDMi205829393.

Proteomic databases

MaxQBiQ5R372.
PaxDbiQ5R372.
PeptideAtlasiQ5R372.
PRIDEiQ5R372.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000251507; ENSP00000251507; ENSG00000152061. [Q5R372-1]
ENST00000325589; ENSP00000318603; ENSG00000152061. [Q5R372-7]
ENST00000347255; ENSP00000281844; ENSG00000152061. [Q5R372-5]
ENST00000357444; ENSP00000350027; ENSG00000152061. [Q5R372-2]
ENST00000367687; ENSP00000356660; ENSG00000152061. [Q5R372-6]
ENST00000478442; ENSP00000434600; ENSG00000152061. [Q5R372-9]
ENST00000486220; ENSP00000432490; ENSG00000152061. [Q5R372-9]
ENST00000489615; ENSP00000420660; ENSG00000152061. [Q5R372-8]
GeneIDi9910.
UCSCiuc001gjw.4. human. [Q5R372-1]

Organism-specific databases

CTDi9910.
DisGeNETi9910.
GeneCardsiRABGAP1L.
H-InvDBHIX0022205.
HGNCiHGNC:24663. RABGAP1L.
HPAiHPA054695.
MIMi609238. gene.
neXtProtiNX_Q5R372.
OpenTargetsiENSG00000152061.
PharmGKBiPA134940645.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1102. Eukaryota.
COG5210. LUCA.
GeneTreeiENSGT00750000117238.
HOVERGENiHBG063892.
InParanoidiQ5R372.
OMAiDTEGDGQ.
OrthoDBiEOG091G0AIH.
PhylomeDBiQ5R372.
TreeFamiTF317184.

Miscellaneous databases

ChiTaRSiRABGAP1L. human.
EvolutionaryTraceiQ5R372.
GenomeRNAii9910.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000152061.
ExpressionAtlasiQ5R372. baseline and differential.
GenevisibleiQ5R372. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR022164. Kinesin-like.
IPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
IPR000195. Rab-GTPase-TBC_dom.
[Graphical view]
PfamiPF12473. DUF3694. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view]
SUPFAMiSSF47923. SSF47923. 2 hits.
SSF50729. SSF50729. 1 hit.
PROSITEiPS01179. PID. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRBG1L_HUMAN
AccessioniPrimary (citable) accession number: Q5R372
Secondary accession number(s): O75059
, Q3ZTR8, Q5R369, Q8IVV0, Q8N921, Q8WV78, Q9NSP8, Q9UQ19, Q9UQP5, Q9Y6Y5, Q9Y6Y6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: February 5, 2008
Last modified: November 2, 2016
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.