Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

C-type lectin domain family 12 member A

Gene

CLEC12A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cell surface receptor that modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases.2 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionReceptor
LigandLectin

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation

Names & Taxonomyi

Protein namesi
Recommended name:
C-type lectin domain family 12 member A
Alternative name(s):
C-type lectin-like molecule 1
Short name:
CLL-1
Dendritic cell-associated lectin 2
Short name:
DCAL-2
Myeloid inhibitory C-type lectin-like receptor
Short name:
MICL
Gene namesi
Name:CLEC12A
Synonyms:CLL1, DCAL2, MICL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000172322.13
HGNCiHGNC:31713 CLEC12A
MIMi612088 gene
neXtProtiNX_Q5QGZ9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 43CytoplasmicSequence analysisAdd BLAST43
Transmembranei44 – 64Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini65 – 265ExtracellularSequence analysisAdd BLAST201

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi160364
OpenTargetsiENSG00000172322
PharmGKBiPA142672094

Polymorphism and mutation databases

BioMutaiCLEC12A
DMDMi308153619

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003135781 – 265C-type lectin domain family 12 member AAdd BLAST265

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi88N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi98N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi161 ↔ 248PROSITE-ProRule annotation
Glycosylationi165N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi227 ↔ 240PROSITE-ProRule annotation

Post-translational modificationi

Highly N-glycosylated. Glycosylation varies between cell types.3 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ5QGZ9
PeptideAtlasiQ5QGZ9
PRIDEiQ5QGZ9
ProteomicsDBi63611
63612 [Q5QGZ9-1]
63613 [Q5QGZ9-3]
63614 [Q5QGZ9-4]
63615 [Q5QGZ9-5]

PTM databases

iPTMnetiQ5QGZ9
PhosphoSitePlusiQ5QGZ9

Expressioni

Tissue specificityi

Detected in normal myeloid cells and in acute myeloid leukemia cells. Detected in neutrophils, eosinophils, monocytes and dendritic cells. Detected in spleen macrophage-rich red pulp and in lymph node (at protein level). Detected in peripheral blood leukocytes, dendritic cells, bone marrow, monocytes, mononuclear leukocytes and macrophages.4 Publications

Inductioni

Down-regulated in activated leukocytes recruited to a site of inflammation.1 Publication

Gene expression databases

BgeeiENSG00000172322
CleanExiHS_CLEC12A
ExpressionAtlasiQ5QGZ9 baseline and differential
GenevisibleiQ5QGZ9 HS

Organism-specific databases

HPAiHPA048515

Interactioni

Subunit structurei

Interacts with PTPN6 and PTPN11.1 Publication

Protein-protein interaction databases

BioGridi127754, 27 interactors
IntActiQ5QGZ9, 1 interactor
STRINGi9606.ENSP00000347916

Structurei

3D structure databases

ProteinModelPortaliQ5QGZ9
SMRiQ5QGZ9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini140 – 249C-type lectinPROSITE-ProRule annotationAdd BLAST110

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi5 – 10ITIM motif6

Domaini

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4297 Eukaryota
ENOG410XPJ1 LUCA
GeneTreeiENSGT00700000104266
HOGENOMiHOG000111777
HOVERGENiHBG107715
InParanoidiQ5QGZ9
KOiK17516
OMAiHKCKPCP
OrthoDBiEOG091G0K57
TreeFamiTF336674

Family and domain databases

CDDicd03593 CLECT_NK_receptors_like, 1 hit
Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
IPR033992 NKR-like_CTLD
PfamiView protein in Pfam
PF00059 Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SUPFAMiSSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q5QGZ9-2) [UniParc]FASTAAdd to basket
Also known as: Alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEEVTYADL QFQNSSEMEK IPEIGKFGEK APPAPSHVWR PAALFLTLLC
60 70 80 90 100
LLLLIGLGVL ASMFHVTLKI EMKKMNKLQN ISEELQRNIS LQLMSNMNIS
110 120 130 140 150
NKIRNLSTTL QTIATKLCRE LYSKEQEHKC KPCPRRWIWH KDSCYFLSDD
160 170 180 190 200
VQTWQESKMA CAAQNASLLK INNKNALEFI KSQSRSYDYW LGLSPEEDST
210 220 230 240 250
RGMRVDNIIN SSAWVIRNAP DLNNMYCGYI NRLYVQYYHC TYKKRMICEK
260
MANPVQLGST YFREA
Length:265
Mass (Da):30,762
Last modified:October 5, 2010 - v3
Checksum:i4255FF1EA9F0D4B1
GO
Isoform 1 (identifier: Q5QGZ9-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWIDFFTYSSM

Show »
Length:275
Mass (Da):32,040
Checksum:i71AA82DBDD039848
GO
Isoform 3 (identifier: Q5QGZ9-3) [UniParc]FASTAAdd to basket
Also known as: Gamma

The sequence of this isoform differs from the canonical sequence as follows:
     64-81: FHVTLKIEMKKMNKLQNI → CMYCPCFGQEEVSRISNI
     82-265: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:81
Mass (Da):8,965
Checksum:iF025075C173112DD
GO
Isoform 4 (identifier: Q5QGZ9-4) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     31-64: APPAPSHVWRPAALFLTLLCLLLLIGLGVLASMF → V

Show »
Length:232
Mass (Da):27,276
Checksum:i3BF3147C5CEB4B45
GO
Isoform 5 (identifier: Q5QGZ9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     214-265: Missing.

Show »
Length:213
Mass (Da):24,449
Checksum:iD026446C70B23B77
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_037669244K → Q6 PublicationsCorresponds to variant dbSNP:rs479499Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0398541M → MWIDFFTYSSM in isoform 1. 1 Publication1
Alternative sequenceiVSP_03003031 – 64APPAP…LASMF → V in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_03003164 – 81FHVTL…KLQNI → CMYCPCFGQEEVSRISNI in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_03003282 – 265Missing in isoform 3. 1 PublicationAdd BLAST184
Alternative sequenceiVSP_030033214 – 265Missing in isoform 5. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY547296 mRNA Translation: AAT11783.1
AY498550 mRNA Translation: AAS00605.1
AY498551 mRNA Translation: AAS00606.1
AY498552 mRNA Translation: AAS00607.1
AY426759 mRNA Translation: AAR84594.1
AF247788 mRNA Translation: AAL95693.1
AK314001 mRNA Translation: BAG36713.1
AC091814 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96133.1
BC063424 mRNA Translation: AAH63424.1
BC126289 mRNA Translation: AAI26290.1
BC126291 mRNA Translation: AAI26292.1
CCDSiCCDS55803.1 [Q5QGZ9-1]
CCDS73442.1 [Q5QGZ9-5]
CCDS8608.1 [Q5QGZ9-2]
CCDS8609.1 [Q5QGZ9-4]
RefSeqiNP_001193939.1, NM_001207010.1 [Q5QGZ9-1]
NP_001287659.1, NM_001300730.1 [Q5QGZ9-5]
NP_612210.4, NM_138337.5 [Q5QGZ9-2]
NP_963917.2, NM_201623.3 [Q5QGZ9-4]
XP_005253381.1, XM_005253324.2 [Q5QGZ9-2]
XP_011518872.1, XM_011520570.1 [Q5QGZ9-2]
UniGeneiHs.190519

Genome annotation databases

EnsembliENST00000304361; ENSP00000302804; ENSG00000172322 [Q5QGZ9-2]
ENST00000350667; ENSP00000345448; ENSG00000172322 [Q5QGZ9-4]
ENST00000355690; ENSP00000347916; ENSG00000172322 [Q5QGZ9-1]
ENST00000434319; ENSP00000405244; ENSG00000172322 [Q5QGZ9-5]
GeneIDi160364
KEGGihsa:160364
UCSCiuc001qwq.3 human [Q5QGZ9-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCL12A_HUMAN
AccessioniPrimary (citable) accession number: Q5QGZ9
Secondary accession number(s): B2RA16
, Q6P4H1, Q6RH77, Q6RH78, Q8TDQ6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: October 5, 2010
Last modified: June 20, 2018
This is version 108 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health