Reviewed,
UniProtKB/Swiss-Prot Q5QGZ9 (CL12A_HUMAN)
Last modified
June 16, 2009.
Version 37.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: C-type lectin domain family 12 member A Alternative name(s): Myeloid inhibitory C-type lectin-like receptor Short name=MICL C-type lectin-like molecule 1 Short name=CLL-1 Dendritic cell-associated lectin 2 Short name=DCAL-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 275 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Cell surface receptor that modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases. Ref.2 Ref.3 |
| Subunit structure | Interacts with PTPN6 and PTPN11. Ref.2 |
| Subcellular location | Cell membrane; Single-pass type II membrane protein. Note: Ligand binding leads to internalization. Ref.2 Ref.3 Ref.1 Ref.9 |
| Tissue specificity | Detected in normal myeloid cells and in acute myeloid leukemia cells. Detected in neutrophils, eosinophils, monocytes and dendritic cells. Detected in spleen macrophage-rich red pulp and in lymph node (at protein level). Detected in peripheral blood leukocytes, dendritic cells, bone marrow, monocytes, mononuclear leukocytes and macrophages. Ref.2 Ref.3 Ref.1 Ref.9 |
| Induction | Down-regulated in activated leukocytes recruited to a site of inflammation. Ref.9 |
| Domain | Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. |
| Post-translational modification | Highly N-glycosylated. Glycosylation varies between cell types. Ref.2 Ref.9 Ref.8 |
| Sequence similarities | Contains 1 C-type lectin domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal-anchor Transmembrane |
| Ligand | Lectin |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Gene Ontology (GO) | |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | receptor activity Inferred from electronic annotation. Source: UniProtKB-KW sugar bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5QGZ9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5QGZ9-2) Also known as: Alpha; The sequence of this isoform differs from the canonical sequence as follows: 1-10: Missing. | ||||||
| Isoform 3 (identifier: Q5QGZ9-3) Also known as: Gamma; The sequence of this isoform differs from the canonical sequence as follows: 1-10: Missing. 74-91: FHVTLKIEMKKMNKLQNI → CMYCPCFGQEEVSRISNI 92-275: Missing. | ||||||
| Isoform 4 (identifier: Q5QGZ9-4) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 1-10: Missing. 41-74: APPAPSHVWRPAALFLTLLCLLLLIGLGVLASMF → V | ||||||
| Isoform 5 (identifier: Q5QGZ9-5) The sequence of this isoform differs from the canonical sequence as follows: 1-10: Missing. 224-275: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 275 | 275 | C-type lectin domain family 12 member A | PRO_0000313578 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 53 | 53 | Cytoplasmic Potential | ||||||||
| Transmembrane | 54 – 74 | 21 | Signal-anchor for type II membrane protein Potential | ||||||||
| Topological domain | 75 – 275 | 201 | Extracellular Potential | ||||||||
| Domain | 150 – 259 | 110 | C-type lectin | ||||||||
| Motif | 15 – 20 | 6 | ITIM motif | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 98 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 108 | 1 | N-linked (GlcNAc...) Ref.8 | ||||||||
| Glycosylation | 175 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 171 ↔ 258 | By similarity | |||||||||
| Disulfide bond | 237 ↔ 250 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 10 | 10 | Missing in isoform 2, isoform 3, isoform 4 and isoform 5. | VSP_030029 | |||||||
| Alternative sequence | 41 – 74 | 34 | APPAP…LASMF → V in isoform 4. | VSP_030030 | |||||||
| Alternative sequence | 74 – 91 | 18 | FHVTL…KLQNI → CMYCPCFGQEEVSRISNI in isoform 3. | VSP_030031 | |||||||
| Alternative sequence | 92 – 275 | 184 | Missing in isoform 3. | VSP_030032 | |||||||
| Alternative sequence | 224 – 275 | 52 | Missing in isoform 5. | VSP_030033 | |||||||
| Natural variant | 254 | 1 | Q → K: dbSNP rs479499. Ref.2 | VAR_037669 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "C-type lectin-like molecule-1: a novel myeloid cell surface marker associated with acute myeloid leukemia." Bakker A.B.H., van den Oudenrijn S., Bakker A.Q., Feller N., van Meijer M., Bia J.A., Jongeneelen M.A.C., Visser T.J., Bijl N., Geuijen C.A.W., Marissen W.E., Radosevic K., Throsby M., Schuurhuis G.J., Ossenkoppele G.J., de Kruif J., Goudsmit J., Kruisbeek A.M. Cancer Res. 64:8443-8450(2004) [PubMed: 15548716] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Bone marrow. |
| [2] | "Identification and characterization of a novel human myeloid inhibitory C-type lectin-like receptor (MICL) that is predominantly expressed on granulocytes and monocytes." Marshall A.S.J., Willment J.A., Lin H.-H., Williams D.L., Gordon S., Brown G.D. J. Biol. Chem. 279:14792-14802(2004) [PubMed: 14739280] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANT LYS-254, FUNCTION, INTERACTION WITH PTPN6 AND PTPN11, SUBCELLULAR LOCATION, GLYCOSYLATION, TISSUE SPECIFICITY. |
| [3] | "Dendritic-cell-associated C-type lectin 2 (DCAL-2) alters dendritic-cell maturation and cytokine production." Chen C.-H., Floyd H., Olson N.E., Magaletti D., Li C., Draves K., Clark E.A. Blood 107:1459-1467(2006) [PubMed: 16239426] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [4] | "Novel human C-type lectin superfamily member CLL-1." Zhang W., Wan T., Chen T., Cao X. Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lung. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5). Tissue: Blood. |
| [8] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed: 16335952] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-108, MASS SPECTROMETRY. Tissue: Plasma. |
| [9] | "Human MICL (CLEC12A) is differentially glycosylated and is down-regulated following cellular activation." Marshall A.S.J., Willment J.A., Pyz E., Dennehy K.M., Reid D.M., Dri P., Gordon S., Wong S.Y.C., Brown G.D. Eur. J. Immunol. 36:2159-2169(2006) [PubMed: 16838277] [Abstract] Cited for: GLYCOSYLATION, INDUCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AY547296 mRNA. Translation: AAT11783.1. AY498550 mRNA. Translation: AAS00605.1. AY498551 mRNA. Translation: AAS00606.1. AY498552 mRNA. Translation: AAS00607.1. AY426759 mRNA. Translation: AAR84594.1. AF247788 mRNA. Translation: AAL95693.1. AK314001 mRNA. Translation: BAG36713.1. CH471094 Genomic DNA. Translation: EAW96133.1. BC063424 mRNA. Translation: AAH63424.1. BC126289 mRNA. Translation: AAI26290.1. BC126291 mRNA. Translation: AAI26292.1. | |
| IPI | IPI00401793. IPI00401794. IPI00747901. IPI00879754. IPI00880140. |
| RefSeq | NP_612210.4. NP_963917.2. |
| UniGene | Hs.190519 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q5QGZ9. |
Genome annotation databases | |
| Ensembl | ENSG00000172322. Homo sapiens. [Contig view] |
| GeneID | 160364. |
| KEGG | hsa:160364. |
Organism-specific databases | |
| GeneCards | GC12P010016. |
| HGNC | HGNC:31713. CLEC12A. |
| MIM | 612088. gene. |
| PharmGKB | PA142672094. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q5QGZ9. |
| HOVERGEN | Q5QGZ9. |
Gene expression databases | |
| ArrayExpress | Q5QGZ9. |
| Bgee | Q5QGZ9. |
| CleanEx | HS_CLEC12A. |
Family and domain databases | |
| InterPro | IPR001304. C-type_lectin. IPR016186. C-type_lectin-like. IPR018378. C-type_lectin_CS. [Graphical view] |
| Gene3D | G3DSA:3.10.100.10. C-type_lectin-like. 1 hit. |
| Pfam | PF00059. Lectin_C. 1 hit. [Graphical view] |
| SMART | SM00034. CLECT. 1 hit. [Graphical view] |
| PROSITE | PS00615. C_TYPE_LECTIN_1. False negative. PS50041. C_TYPE_LECTIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | CL12A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5QGZ9 Secondary accession number(s): B2RA16 Q8TDQ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


