Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Urea transporter 1

Gene

SLC14A1

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.2 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei334 – 3341Important for channel permeability

GO - Molecular functioni

  • urea channel activity Source: UniProtKB
  • water transmembrane transporter activity Source: Ensembl

GO - Biological processi

  • urea transmembrane transport Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiREACT_301947. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Names & Taxonomyi

Protein namesi
Recommended name:
Urea transporter 1
Alternative name(s):
Solute carrier family 14 member 1
Urea transporter B
Short name:
UT-B
Urea transporter, erythrocyte
Gene namesi
Name:SLC14A1
Synonyms:UT-B
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
ProteomesiUP000009136 Componenti: Chromosome 24

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Intramembranei47 – 6418HelicalAdd
BLAST
Intramembranei68 – 8316HelicalAdd
BLAST
Transmembranei86 – 10520HelicalAdd
BLAST
Transmembranei110 – 13223HelicalAdd
BLAST
Transmembranei139 – 16325HelicalAdd
BLAST
Transmembranei168 – 18821HelicalAdd
BLAST
Intramembranei215 – 22915HelicalAdd
BLAST
Intramembranei234 – 24512HelicalAdd
BLAST
Transmembranei250 – 26920HelicalAdd
BLAST
Transmembranei279 – 29921HelicalAdd
BLAST
Transmembranei304 – 32522HelicalAdd
BLAST
Transmembranei328 – 34821HelicalAdd
BLAST

GO - Cellular componenti

  • basolateral plasma membrane Source: UniProtKB-SubCell
  • integral component of plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi172 – 1721T → S: No effect on urea channel activity. 1 Publication
Mutagenesisi334 – 3341T → S: No effect on urea channel activity. 1 Publication
Mutagenesisi334 – 3341T → V: Nearly abolishes urea channel activity. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 384384Urea transporter 1PRO_0000410962Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi206 – 2061N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PRIDEiQ5QF96.

Expressioni

Tissue specificityi

Isoform 1 and isoform 2 are expressed in kidney. Also expressed in the rumen (at protein level). Isoform 2 seems predominant in both tissues.1 Publication

Interactioni

Subunit structurei

Identified in a complex with STOM (By similarity). Homotrimer; each subunit contains a pore through which urea permeates.By similarity1 Publication

Protein-protein interaction databases

DIPiDIP-60048N.
STRINGi9913.ENSBTAP00000044109.

Structurei

Secondary structure

1
384
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi38 – 458Combined sources
Helixi49 – 6214Combined sources
Helixi63 – 653Combined sources
Helixi70 – 8314Combined sources
Helixi85 – 10420Combined sources
Helixi109 – 1146Combined sources
Turni115 – 1184Combined sources
Helixi119 – 13012Combined sources
Helixi139 – 1413Combined sources
Helixi142 – 16322Combined sources
Helixi164 – 1663Combined sources
Helixi173 – 18614Combined sources
Beta strandi191 – 1933Combined sources
Helixi209 – 2113Combined sources
Helixi214 – 22613Combined sources
Helixi227 – 2293Combined sources
Helixi234 – 24714Combined sources
Helixi249 – 26820Combined sources
Helixi273 – 2775Combined sources
Turni278 – 2825Combined sources
Helixi283 – 29210Combined sources
Turni293 – 2953Combined sources
Helixi301 – 32626Combined sources
Turni327 – 3293Combined sources
Helixi335 – 34511Combined sources
Helixi359 – 3613Combined sources
Helixi365 – 37410Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4EZCX-ray2.36A/B/C1-384[»]
4EZDX-ray2.50A/B/C1-384[»]
ProteinModelPortaliQ5QF96.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the urea transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG4413.
GeneTreeiENSGT00390000018729.
HOGENOMiHOG000065705.
HOVERGENiHBG000540.
InParanoidiQ5QF96.
KOiK08716.
OMAiVGVGQIY.
OrthoDBiEOG7GBFX8.
TreeFamiTF332858.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERiPTHR10464. PTHR10464. 1 hit.
PfamiPF03253. UT. 1 hit.
[Graphical view]
PIRSFiPIRSF016502. Urea_transporter. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5QF96-1) [UniParc]FASTAAdd to basket

Also known as: UT-B1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDDNPTAVKL DQGGNQAPQG RGRRCLPKAL GYITGDMKEF ANWLKDKPQA
60 70 80 90 100
LQFVDWVLRG ISQVVFVSNP ISGILILVGL LVQNPWCALN GCVGTVVSTL
110 120 130 140 150
TALLLSQDRS AITAGLQGYN ATLVGILMAI YSDKGNYFWW LLFPVSAMSM
160 170 180 190 200
TCPVFSSALN SVLSKWDLPV FTLPFNMALS MYLSATGHYN PFFPSTLITP
210 220 230 240 250
VTSVPNVTWP DLSALQLLKS LPVGVGQIYG CDNPWTGGIF LGAILLSSPL
260 270 280 290 300
MCLHAAIGSL LGIIAGLSLS APFEDIYAGL WGFNSSLACI AIGGTFMALT
310 320 330 340 350
WQTHLLALAC ALFTAYLGAS MSHVMAVVGL PSGTWPFCLA TLLFLLLTTK
360 370 380
NPNIYKMPIS KVTYPEENRI FYLQSRKRTV QGPL
Length:384
Mass (Da):41,473
Last modified:January 4, 2005 - v1
Checksum:i7AC8203F8A4E88A1
GO
Isoform 2 (identifier: Q5QF96-2) [UniParc]FASTAAdd to basket

Also known as: UT-B2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGRSLIGAAGDAYPGPLWRGPFGKKSGEAAHRVFPWINLAVVQGPEEQEPEETSM

Show »
Length:439
Mass (Da):47,334
Checksum:iB301A1BA65CCE8A2
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti54 – 541V → I in AAI05334 (Ref. 2) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MSGRSLIGAAGDAYPGPLWR GPFGKKSGEAAHRVFPWINL AVVQGPEEQEPEETSM in isoform 2. 1 PublicationVSP_041575

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY624602 mRNA. Translation: AAU94647.1.
AY838799 Genomic DNA. Translation: AAW02793.1.
AY838799 Genomic DNA. Translation: AAW51203.1.
BC105333 mRNA. Translation: AAI05334.1.
RefSeqiNP_001008666.1. NM_001008666.1. [Q5QF96-1]
XP_005224169.1. XM_005224112.2. [Q5QF96-2]
XP_005224170.1. XM_005224113.2. [Q5QF96-2]
XP_005224171.1. XM_005224114.2. [Q5QF96-2]
XP_005224173.1. XM_005224116.2. [Q5QF96-1]
XP_010817116.1. XM_010818814.1. [Q5QF96-1]
UniGeneiBt.66422.

Genome annotation databases

EnsembliENSBTAT00000026475; ENSBTAP00000026475; ENSBTAG00000019870. [Q5QF96-1]
ENSBTAT00000046861; ENSBTAP00000044109; ENSBTAG00000019870. [Q5QF96-1]
GeneIDi493988.
KEGGibta:493988.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY624602 mRNA. Translation: AAU94647.1.
AY838799 Genomic DNA. Translation: AAW02793.1.
AY838799 Genomic DNA. Translation: AAW51203.1.
BC105333 mRNA. Translation: AAI05334.1.
RefSeqiNP_001008666.1. NM_001008666.1. [Q5QF96-1]
XP_005224169.1. XM_005224112.2. [Q5QF96-2]
XP_005224170.1. XM_005224113.2. [Q5QF96-2]
XP_005224171.1. XM_005224114.2. [Q5QF96-2]
XP_005224173.1. XM_005224116.2. [Q5QF96-1]
XP_010817116.1. XM_010818814.1. [Q5QF96-1]
UniGeneiBt.66422.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4EZCX-ray2.36A/B/C1-384[»]
4EZDX-ray2.50A/B/C1-384[»]
ProteinModelPortaliQ5QF96.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-60048N.
STRINGi9913.ENSBTAP00000044109.

Proteomic databases

PRIDEiQ5QF96.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSBTAT00000026475; ENSBTAP00000026475; ENSBTAG00000019870. [Q5QF96-1]
ENSBTAT00000046861; ENSBTAP00000044109; ENSBTAG00000019870. [Q5QF96-1]
GeneIDi493988.
KEGGibta:493988.

Organism-specific databases

CTDi6563.

Phylogenomic databases

eggNOGiCOG4413.
GeneTreeiENSGT00390000018729.
HOGENOMiHOG000065705.
HOVERGENiHBG000540.
InParanoidiQ5QF96.
KOiK08716.
OMAiVGVGQIY.
OrthoDBiEOG7GBFX8.
TreeFamiTF332858.

Enzyme and pathway databases

ReactomeiREACT_301947. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Miscellaneous databases

NextBioi20865519.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERiPTHR10464. PTHR10464. 1 hit.
PfamiPF03253. UT. 1 hit.
[Graphical view]
PIRSFiPIRSF016502. Urea_transporter. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "UT-B is expressed in bovine rumen: potential role in ruminal urea transport."
    Stewart G.S., Graham C., Cattell S., Smith T.P., Simmons N.L., Smith C.P.
    Am. J. Physiol. 289:R605-R612(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  2. NIH - Mammalian Gene Collection (MGC) project
    Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: Crossbred X Angus.
    Tissue: Ileum.
  3. "Structure and permeation mechanism of a mammalian urea transporter."
    Levin E.J., Cao Y., Enkavi G., Quick M., Pan Y., Tajkhorshid E., Zhou M.
    Proc. Natl. Acad. Sci. U.S.A. 109:11194-11199(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.36 ANGSTROMS), FUNCTION, SUBUNIT, REGULATION BY OSMOTIC STRESS, SUBCELLULAR LOCATION, MUTAGENESIS OF THR-172 AND THR-334.

Entry informationi

Entry nameiUT1_BOVIN
AccessioniPrimary (citable) accession number: Q5QF96
Secondary accession number(s): Q2KJI0, Q2TM53
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 28, 2011
Last sequence update: January 4, 2005
Last modified: June 24, 2015
This is version 63 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.