SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5QF96

- UT1_BOVIN

UniProt

Q5QF96 - UT1_BOVIN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Urea transporter 1

Gene
SLC14A1, UT-B
Organism
Bos taurus (Bovine)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei334 – 3341Important for channel permeability

GO - Molecular functioni

  1. urea channel activity Source: UniProtKB
  2. water transmembrane transporter activity Source: Ensembl

GO - Biological processi

  1. urea transmembrane transport Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiREACT_212003. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Names & Taxonomyi

Protein namesi
Recommended name:
Urea transporter 1
Alternative name(s):
Solute carrier family 14 member 1
Urea transporter B
Short name:
UT-B
Urea transporter, erythrocyte
Gene namesi
Name:SLC14A1
Synonyms:UT-B
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
ProteomesiUP000009136: Chromosome 24

Subcellular locationi

Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein
Note: Restricted to the basolateral membrane in various portions of the urothelium.2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Intramembranei47 – 6418HelicalAdd
BLAST
Intramembranei68 – 8316HelicalAdd
BLAST
Transmembranei86 – 10520HelicalAdd
BLAST
Transmembranei110 – 13223HelicalAdd
BLAST
Transmembranei139 – 16325HelicalAdd
BLAST
Transmembranei168 – 18821HelicalAdd
BLAST
Intramembranei215 – 22915HelicalAdd
BLAST
Intramembranei234 – 24512HelicalAdd
BLAST
Transmembranei250 – 26920HelicalAdd
BLAST
Transmembranei279 – 29921HelicalAdd
BLAST
Transmembranei304 – 32522HelicalAdd
BLAST
Transmembranei328 – 34821HelicalAdd
BLAST

GO - Cellular componenti

  1. basolateral plasma membrane Source: UniProtKB-SubCell
  2. integral component of plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi172 – 1721T → S: No effect on urea channel activity.
Mutagenesisi334 – 3341T → S: No effect on urea channel activity.
Mutagenesisi334 – 3341T → V: Nearly abolishes urea channel activity.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 384384Urea transporter 1PRO_0000410962Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi206 – 2061N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

PRIDEiQ5QF96.

Expressioni

Tissue specificityi

Isoform 1 and isoform 2 are expressed in kidney. Also expressed in the rumen (at protein level). Isoform 2 seems predominant in both tissues.1 Publication

Interactioni

Subunit structurei

Identified in a complex with STOM By similarity. Homotrimer; each subunit contains a pore through which urea permeates.1 Publication

Protein-protein interaction databases

DIPiDIP-60048N.
STRINGi9913.ENSBTAP00000044108.

Structurei

Secondary structure

1
384
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi38 – 458
Helixi49 – 6214
Helixi63 – 653
Helixi70 – 8314
Helixi85 – 10420
Helixi109 – 1146
Turni115 – 1184
Helixi119 – 13012
Helixi139 – 1413
Helixi142 – 16322
Helixi164 – 1663
Helixi173 – 18614
Beta strandi191 – 1933
Helixi209 – 2113
Helixi214 – 22613
Helixi227 – 2293
Helixi234 – 24714
Helixi249 – 26820
Helixi273 – 2775
Turni278 – 2825
Helixi283 – 29210
Turni293 – 2953
Helixi301 – 32626
Turni327 – 3293
Helixi335 – 34511
Helixi359 – 3613
Helixi365 – 37410

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4EZCX-ray2.36A/B/C1-384[»]
4EZDX-ray2.50A/B/C1-384[»]
ProteinModelPortaliQ5QF96.

Family & Domainsi

Sequence similaritiesi

Belongs to the urea transporter family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG4413.
GeneTreeiENSGT00390000018729.
HOGENOMiHOG000065705.
HOVERGENiHBG000540.
InParanoidiQ2TM53.
KOiK08716.
OMAiPNIYKMP.
OrthoDBiEOG7GBFX8.
TreeFamiTF332858.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERiPTHR10464. PTHR10464. 1 hit.
PfamiPF03253. UT. 1 hit.
[Graphical view]
PIRSFiPIRSF016502. Urea_transporter. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5QF96-1) [UniParc]FASTAAdd to Basket

Also known as: UT-B1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDDNPTAVKL DQGGNQAPQG RGRRCLPKAL GYITGDMKEF ANWLKDKPQA    50
LQFVDWVLRG ISQVVFVSNP ISGILILVGL LVQNPWCALN GCVGTVVSTL 100
TALLLSQDRS AITAGLQGYN ATLVGILMAI YSDKGNYFWW LLFPVSAMSM 150
TCPVFSSALN SVLSKWDLPV FTLPFNMALS MYLSATGHYN PFFPSTLITP 200
VTSVPNVTWP DLSALQLLKS LPVGVGQIYG CDNPWTGGIF LGAILLSSPL 250
MCLHAAIGSL LGIIAGLSLS APFEDIYAGL WGFNSSLACI AIGGTFMALT 300
WQTHLLALAC ALFTAYLGAS MSHVMAVVGL PSGTWPFCLA TLLFLLLTTK 350
NPNIYKMPIS KVTYPEENRI FYLQSRKRTV QGPL 384
Length:384
Mass (Da):41,473
Last modified:January 4, 2005 - v1
Checksum:i7AC8203F8A4E88A1
GO
Isoform 2 (identifier: Q5QF96-2) [UniParc]FASTAAdd to Basket

Also known as: UT-B2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGRSLIGAAGDAYPGPLWRGPFGKKSGEAAHRVFPWINLAVVQGPEEQEPEETSM

Show »
Length:439
Mass (Da):47,334
Checksum:iB301A1BA65CCE8A2
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MSGRSLIGAAGDAYPGPLWR GPFGKKSGEAAHRVFPWINL AVVQGPEEQEPEETSM in isoform 2. VSP_041575

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti54 – 541V → I in AAI05334. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY624602 mRNA. Translation: AAU94647.1.
AY838799 Genomic DNA. Translation: AAW02793.1.
AY838799 Genomic DNA. Translation: AAW51203.1.
BC105333 mRNA. Translation: AAI05334.1.
RefSeqiNP_001008666.1. NM_001008666.1. [Q5QF96-1]
XP_005224169.1. XM_005224112.1. [Q5QF96-2]
XP_005224170.1. XM_005224113.1. [Q5QF96-2]
XP_005224171.1. XM_005224114.1. [Q5QF96-2]
XP_005224172.1. XM_005224115.1. [Q5QF96-2]
XP_005224173.1. XM_005224116.1. [Q5QF96-1]
UniGeneiBt.66422.

Genome annotation databases

EnsembliENSBTAT00000026475; ENSBTAP00000026475; ENSBTAG00000019870. [Q5QF96-1]
ENSBTAT00000046861; ENSBTAP00000044109; ENSBTAG00000019870. [Q5QF96-1]
GeneIDi493988.
KEGGibta:493988.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY624602 mRNA. Translation: AAU94647.1 .
AY838799 Genomic DNA. Translation: AAW02793.1 .
AY838799 Genomic DNA. Translation: AAW51203.1 .
BC105333 mRNA. Translation: AAI05334.1 .
RefSeqi NP_001008666.1. NM_001008666.1. [Q5QF96-1 ]
XP_005224169.1. XM_005224112.1. [Q5QF96-2 ]
XP_005224170.1. XM_005224113.1. [Q5QF96-2 ]
XP_005224171.1. XM_005224114.1. [Q5QF96-2 ]
XP_005224172.1. XM_005224115.1. [Q5QF96-2 ]
XP_005224173.1. XM_005224116.1. [Q5QF96-1 ]
UniGenei Bt.66422.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4EZC X-ray 2.36 A/B/C 1-384 [» ]
4EZD X-ray 2.50 A/B/C 1-384 [» ]
ProteinModelPortali Q5QF96.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-60048N.
STRINGi 9913.ENSBTAP00000044108.

Proteomic databases

PRIDEi Q5QF96.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSBTAT00000026475 ; ENSBTAP00000026475 ; ENSBTAG00000019870 . [Q5QF96-1 ]
ENSBTAT00000046861 ; ENSBTAP00000044109 ; ENSBTAG00000019870 . [Q5QF96-1 ]
GeneIDi 493988.
KEGGi bta:493988.

Organism-specific databases

CTDi 6563.

Phylogenomic databases

eggNOGi COG4413.
GeneTreei ENSGT00390000018729.
HOGENOMi HOG000065705.
HOVERGENi HBG000540.
InParanoidi Q2TM53.
KOi K08716.
OMAi PNIYKMP.
OrthoDBi EOG7GBFX8.
TreeFami TF332858.

Enzyme and pathway databases

Reactomei REACT_212003. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Miscellaneous databases

NextBioi 20865519.

Family and domain databases

Gene3Di 1.10.3430.10. 1 hit.
InterProi IPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view ]
PANTHERi PTHR10464. PTHR10464. 1 hit.
Pfami PF03253. UT. 1 hit.
[Graphical view ]
PIRSFi PIRSF016502. Urea_transporter. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "UT-B is expressed in bovine rumen: potential role in ruminal urea transport."
    Stewart G.S., Graham C., Cattell S., Smith T.P., Simmons N.L., Smith C.P.
    Am. J. Physiol. 289:R605-R612(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  2. NIH - Mammalian Gene Collection (MGC) project
    Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: Crossbred X Angus.
    Tissue: Ileum.
  3. "Structure and permeation mechanism of a mammalian urea transporter."
    Levin E.J., Cao Y., Enkavi G., Quick M., Pan Y., Tajkhorshid E., Zhou M.
    Proc. Natl. Acad. Sci. U.S.A. 109:11194-11199(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.36 ANGSTROMS), FUNCTION, SUBUNIT, REGULATION BY OSMOTIC STRESS, SUBCELLULAR LOCATION, MUTAGENESIS OF THR-172 AND THR-334.

Entry informationi

Entry nameiUT1_BOVIN
AccessioniPrimary (citable) accession number: Q5QF96
Secondary accession number(s): Q2KJI0, Q2TM53
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 28, 2011
Last sequence update: January 4, 2005
Last modified: September 3, 2014
This is version 56 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi