Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5QF96

- UT1_BOVIN

UniProt

Q5QF96 - UT1_BOVIN

Protein

Urea transporter 1

Gene

SLC14A1

Organism
Bos taurus (Bovine)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 57 (01 Oct 2014)
      Sequence version 1 (04 Jan 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.2 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei334 – 3341Important for channel permeability

    GO - Molecular functioni

    1. urea channel activity Source: UniProtKB
    2. water transmembrane transporter activity Source: Ensembl

    GO - Biological processi

    1. urea transmembrane transport Source: UniProtKB

    Keywords - Biological processi

    Transport

    Enzyme and pathway databases

    ReactomeiREACT_212003. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Urea transporter 1
    Alternative name(s):
    Solute carrier family 14 member 1
    Urea transporter B
    Short name:
    UT-B
    Urea transporter, erythrocyte
    Gene namesi
    Name:SLC14A1
    Synonyms:UT-B
    OrganismiBos taurus (Bovine)
    Taxonomic identifieri9913 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
    ProteomesiUP000009136: Chromosome 24

    Subcellular locationi

    Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein
    Note: Restricted to the basolateral membrane in various portions of the urothelium.

    GO - Cellular componenti

    1. basolateral plasma membrane Source: UniProtKB-SubCell
    2. integral component of plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi172 – 1721T → S: No effect on urea channel activity. 1 Publication
    Mutagenesisi334 – 3341T → S: No effect on urea channel activity. 1 Publication
    Mutagenesisi334 – 3341T → V: Nearly abolishes urea channel activity. 1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 384384Urea transporter 1PRO_0000410962Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi206 – 2061N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PRIDEiQ5QF96.

    Expressioni

    Tissue specificityi

    Isoform 1 and isoform 2 are expressed in kidney. Also expressed in the rumen (at protein level). Isoform 2 seems predominant in both tissues.1 Publication

    Interactioni

    Subunit structurei

    Identified in a complex with STOM By similarity. Homotrimer; each subunit contains a pore through which urea permeates.By similarity1 Publication

    Protein-protein interaction databases

    DIPiDIP-60048N.
    STRINGi9913.ENSBTAP00000044108.

    Structurei

    Secondary structure

    1
    384
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi38 – 458
    Helixi49 – 6214
    Helixi63 – 653
    Helixi70 – 8314
    Helixi85 – 10420
    Helixi109 – 1146
    Turni115 – 1184
    Helixi119 – 13012
    Helixi139 – 1413
    Helixi142 – 16322
    Helixi164 – 1663
    Helixi173 – 18614
    Beta strandi191 – 1933
    Helixi209 – 2113
    Helixi214 – 22613
    Helixi227 – 2293
    Helixi234 – 24714
    Helixi249 – 26820
    Helixi273 – 2775
    Turni278 – 2825
    Helixi283 – 29210
    Turni293 – 2953
    Helixi301 – 32626
    Turni327 – 3293
    Helixi335 – 34511
    Helixi359 – 3613
    Helixi365 – 37410

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    4EZCX-ray2.36A/B/C1-384[»]
    4EZDX-ray2.50A/B/C1-384[»]
    ProteinModelPortaliQ5QF96.
    ModBaseiSearch...
    MobiDBiSearch...

    Intramembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Intramembranei47 – 6418HelicalAdd
    BLAST
    Intramembranei68 – 8316HelicalAdd
    BLAST
    Intramembranei215 – 22915HelicalAdd
    BLAST
    Intramembranei234 – 24512HelicalAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei86 – 10520HelicalAdd
    BLAST
    Transmembranei110 – 13223HelicalAdd
    BLAST
    Transmembranei139 – 16325HelicalAdd
    BLAST
    Transmembranei168 – 18821HelicalAdd
    BLAST
    Transmembranei250 – 26920HelicalAdd
    BLAST
    Transmembranei279 – 29921HelicalAdd
    BLAST
    Transmembranei304 – 32522HelicalAdd
    BLAST
    Transmembranei328 – 34821HelicalAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the urea transporter family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG4413.
    GeneTreeiENSGT00390000018729.
    HOGENOMiHOG000065705.
    HOVERGENiHBG000540.
    InParanoidiQ2TM53.
    KOiK08716.
    OMAiPNIYKMP.
    OrthoDBiEOG7GBFX8.
    TreeFamiTF332858.

    Family and domain databases

    Gene3Di1.10.3430.10. 1 hit.
    InterProiIPR029020. Ammonium/urea_transptr.
    IPR004937. Urea_transporter.
    [Graphical view]
    PANTHERiPTHR10464. PTHR10464. 1 hit.
    PfamiPF03253. UT. 1 hit.
    [Graphical view]
    PIRSFiPIRSF016502. Urea_transporter. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5QF96-1) [UniParc]FASTAAdd to Basket

    Also known as: UT-B1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDDNPTAVKL DQGGNQAPQG RGRRCLPKAL GYITGDMKEF ANWLKDKPQA    50
    LQFVDWVLRG ISQVVFVSNP ISGILILVGL LVQNPWCALN GCVGTVVSTL 100
    TALLLSQDRS AITAGLQGYN ATLVGILMAI YSDKGNYFWW LLFPVSAMSM 150
    TCPVFSSALN SVLSKWDLPV FTLPFNMALS MYLSATGHYN PFFPSTLITP 200
    VTSVPNVTWP DLSALQLLKS LPVGVGQIYG CDNPWTGGIF LGAILLSSPL 250
    MCLHAAIGSL LGIIAGLSLS APFEDIYAGL WGFNSSLACI AIGGTFMALT 300
    WQTHLLALAC ALFTAYLGAS MSHVMAVVGL PSGTWPFCLA TLLFLLLTTK 350
    NPNIYKMPIS KVTYPEENRI FYLQSRKRTV QGPL 384
    Length:384
    Mass (Da):41,473
    Last modified:January 4, 2005 - v1
    Checksum:i7AC8203F8A4E88A1
    GO
    Isoform 2 (identifier: Q5QF96-2) [UniParc]FASTAAdd to Basket

    Also known as: UT-B2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSGRSLIGAAGDAYPGPLWRGPFGKKSGEAAHRVFPWINLAVVQGPEEQEPEETSM

    Show »
    Length:439
    Mass (Da):47,334
    Checksum:iB301A1BA65CCE8A2
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti54 – 541V → I in AAI05334. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MSGRSLIGAAGDAYPGPLWR GPFGKKSGEAAHRVFPWINL AVVQGPEEQEPEETSM in isoform 2. 1 PublicationVSP_041575

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY624602 mRNA. Translation: AAU94647.1.
    AY838799 Genomic DNA. Translation: AAW02793.1.
    AY838799 Genomic DNA. Translation: AAW51203.1.
    BC105333 mRNA. Translation: AAI05334.1.
    RefSeqiNP_001008666.1. NM_001008666.1. [Q5QF96-1]
    XP_005224169.1. XM_005224112.1. [Q5QF96-2]
    XP_005224170.1. XM_005224113.1. [Q5QF96-2]
    XP_005224171.1. XM_005224114.1. [Q5QF96-2]
    XP_005224172.1. XM_005224115.1. [Q5QF96-2]
    XP_005224173.1. XM_005224116.1. [Q5QF96-1]
    UniGeneiBt.66422.

    Genome annotation databases

    EnsembliENSBTAT00000026475; ENSBTAP00000026475; ENSBTAG00000019870. [Q5QF96-1]
    ENSBTAT00000046861; ENSBTAP00000044109; ENSBTAG00000019870. [Q5QF96-1]
    GeneIDi493988.
    KEGGibta:493988.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY624602 mRNA. Translation: AAU94647.1 .
    AY838799 Genomic DNA. Translation: AAW02793.1 .
    AY838799 Genomic DNA. Translation: AAW51203.1 .
    BC105333 mRNA. Translation: AAI05334.1 .
    RefSeqi NP_001008666.1. NM_001008666.1. [Q5QF96-1 ]
    XP_005224169.1. XM_005224112.1. [Q5QF96-2 ]
    XP_005224170.1. XM_005224113.1. [Q5QF96-2 ]
    XP_005224171.1. XM_005224114.1. [Q5QF96-2 ]
    XP_005224172.1. XM_005224115.1. [Q5QF96-2 ]
    XP_005224173.1. XM_005224116.1. [Q5QF96-1 ]
    UniGenei Bt.66422.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    4EZC X-ray 2.36 A/B/C 1-384 [» ]
    4EZD X-ray 2.50 A/B/C 1-384 [» ]
    ProteinModelPortali Q5QF96.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-60048N.
    STRINGi 9913.ENSBTAP00000044108.

    Proteomic databases

    PRIDEi Q5QF96.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSBTAT00000026475 ; ENSBTAP00000026475 ; ENSBTAG00000019870 . [Q5QF96-1 ]
    ENSBTAT00000046861 ; ENSBTAP00000044109 ; ENSBTAG00000019870 . [Q5QF96-1 ]
    GeneIDi 493988.
    KEGGi bta:493988.

    Organism-specific databases

    CTDi 6563.

    Phylogenomic databases

    eggNOGi COG4413.
    GeneTreei ENSGT00390000018729.
    HOGENOMi HOG000065705.
    HOVERGENi HBG000540.
    InParanoidi Q2TM53.
    KOi K08716.
    OMAi PNIYKMP.
    OrthoDBi EOG7GBFX8.
    TreeFami TF332858.

    Enzyme and pathway databases

    Reactomei REACT_212003. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

    Miscellaneous databases

    NextBioi 20865519.

    Family and domain databases

    Gene3Di 1.10.3430.10. 1 hit.
    InterProi IPR029020. Ammonium/urea_transptr.
    IPR004937. Urea_transporter.
    [Graphical view ]
    PANTHERi PTHR10464. PTHR10464. 1 hit.
    Pfami PF03253. UT. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF016502. Urea_transporter. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "UT-B is expressed in bovine rumen: potential role in ruminal urea transport."
      Stewart G.S., Graham C., Cattell S., Smith T.P., Simmons N.L., Smith C.P.
      Am. J. Physiol. 289:R605-R612(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    2. NIH - Mammalian Gene Collection (MGC) project
      Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: Crossbred X Angus.
      Tissue: Ileum.
    3. "Structure and permeation mechanism of a mammalian urea transporter."
      Levin E.J., Cao Y., Enkavi G., Quick M., Pan Y., Tajkhorshid E., Zhou M.
      Proc. Natl. Acad. Sci. U.S.A. 109:11194-11199(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.36 ANGSTROMS), FUNCTION, SUBUNIT, REGULATION BY OSMOTIC STRESS, SUBCELLULAR LOCATION, MUTAGENESIS OF THR-172 AND THR-334.

    Entry informationi

    Entry nameiUT1_BOVIN
    AccessioniPrimary (citable) accession number: Q5QF96
    Secondary accession number(s): Q2KJI0, Q2TM53
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 28, 2011
    Last sequence update: January 4, 2005
    Last modified: October 1, 2014
    This is version 57 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3