Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5QF96 (UT1_BOVIN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 55. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Urea transporter 1
Alternative name(s):
Solute carrier family 14 member 1
Urea transporter B
Short name=UT-B
Urea transporter, erythrocyte
Gene names
Name:SLC14A1
Synonyms:UT-B
OrganismBos taurus (Bovine) [Reference proteome]
Taxonomic identifier9913 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos

Protein attributes

Sequence length384 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Mediates urea transport in erythrocytes By similarity. Low-affinity facilitative urea transporter that allow rapid equilibration between the urinary space and the hyperosmotic interstitium. the rate of urea conduction is increased by hypoosmotic stress. Ref.1 Ref.3

Subunit structure

Identified in a complex with STOM By similarity. Homotrimer. Ref.3

Subcellular location

Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Note: Restricted to the basolateral membrane in various portions of the urothelium. Ref.1 Ref.3

Tissue specificity

Isoform 1 and isoform 2 are expressed in kidney. Also expressed in the rumen (at protein level). Isoform 2 seems predominant in both tissues. Ref.1

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5QF96-1)

Also known as: UT-B1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5QF96-2)

Also known as: UT-B2;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGRSLIGAAGDAYPGPLWRGPFGKKSGEAAHRVFPWINLAVVQGPEEQEPEETSM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 384384Urea transporter 1
PRO_0000410962

Regions

Transmembrane61 – 8121Helical; Potential
Transmembrane85 – 10521Helical; Potential
Transmembrane111 – 13121Helical; Potential
Transmembrane138 – 15821Helical; Potential
Transmembrane168 – 18821Helical; Potential
Transmembrane237 – 25721Helical; Potential
Transmembrane279 – 29921Helical; Potential
Transmembrane305 – 32521Helical; Potential
Transmembrane327 – 34721Helical; Potential

Amino acid modifications

Glycosylation2061N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence11M → MSGRSLIGAAGDAYPGPLWR GPFGKKSGEAAHRVFPWINL AVVQGPEEQEPEETSM in isoform 2.
VSP_041575

Experimental info

Sequence conflict541V → I in AAI05334. Ref.2

Secondary structure

............................................. 384
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (UT-B1) [UniParc].

Last modified January 4, 2005. Version 1.
Checksum: 7AC8203F8A4E88A1

FASTA38441,473
        10         20         30         40         50         60 
MDDNPTAVKL DQGGNQAPQG RGRRCLPKAL GYITGDMKEF ANWLKDKPQA LQFVDWVLRG 

        70         80         90        100        110        120 
ISQVVFVSNP ISGILILVGL LVQNPWCALN GCVGTVVSTL TALLLSQDRS AITAGLQGYN 

       130        140        150        160        170        180 
ATLVGILMAI YSDKGNYFWW LLFPVSAMSM TCPVFSSALN SVLSKWDLPV FTLPFNMALS 

       190        200        210        220        230        240 
MYLSATGHYN PFFPSTLITP VTSVPNVTWP DLSALQLLKS LPVGVGQIYG CDNPWTGGIF 

       250        260        270        280        290        300 
LGAILLSSPL MCLHAAIGSL LGIIAGLSLS APFEDIYAGL WGFNSSLACI AIGGTFMALT 

       310        320        330        340        350        360 
WQTHLLALAC ALFTAYLGAS MSHVMAVVGL PSGTWPFCLA TLLFLLLTTK NPNIYKMPIS 

       370        380 
KVTYPEENRI FYLQSRKRTV QGPL 

« Hide

Isoform 2 (UT-B2) [UniParc].

Checksum: B301A1BA65CCE8A2
Show »

FASTA43947,334

References

« Hide 'large scale' references
[1]"UT-B is expressed in bovine rumen: potential role in ruminal urea transport."
Stewart G.S., Graham C., Cattell S., Smith T.P., Simmons N.L., Smith C.P.
Am. J. Physiol. 289:R605-R612(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[2]NIH - Mammalian Gene Collection (MGC) project
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: Crossbred X Angus.
Tissue: Ileum.
[3]"Structure and permeation mechanism of a mammalian urea transporter."
Levin E.J., Cao Y., Enkavi G., Quick M., Pan Y., Tajkhorshid E., Zhou M.
Proc. Natl. Acad. Sci. U.S.A. 109:11194-11199(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.36 ANGSTROMS), FUNCTION, SUBUNIT, REGULATION BY OSMOTIC STRESS, SUBCELLULAR LOCATION.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY624602 mRNA. Translation: AAU94647.1.
AY838799 Genomic DNA. Translation: AAW02793.1.
AY838799 Genomic DNA. Translation: AAW51203.1.
BC105333 mRNA. Translation: AAI05334.1.
RefSeqNP_001008666.1. NM_001008666.1. [Q5QF96-1]
XP_005224169.1. XM_005224112.1. [Q5QF96-2]
XP_005224170.1. XM_005224113.1. [Q5QF96-2]
XP_005224171.1. XM_005224114.1. [Q5QF96-2]
XP_005224172.1. XM_005224115.1. [Q5QF96-2]
XP_005224173.1. XM_005224116.1. [Q5QF96-1]
UniGeneBt.66422.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
4EZCX-ray2.36A/B/C1-384[»]
4EZDX-ray2.50A/B/C1-384[»]
ProteinModelPortalQ5QF96.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-60048N.
STRING9913.ENSBTAP00000044108.

Proteomic databases

PRIDEQ5QF96.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSBTAT00000026475; ENSBTAP00000026475; ENSBTAG00000019870. [Q5QF96-1]
ENSBTAT00000046861; ENSBTAP00000044109; ENSBTAG00000019870. [Q5QF96-1]
GeneID493988.
KEGGbta:493988.

Organism-specific databases

CTD6563.

Phylogenomic databases

eggNOGCOG4413.
GeneTreeENSGT00390000018729.
HOGENOMHOG000065705.
HOVERGENHBG000540.
InParanoidQ2TM53.
KOK08716.
OMAPNIYKMP.
OrthoDBEOG7GBFX8.
TreeFamTF332858.

Family and domain databases

Gene3D1.10.3430.10. 1 hit.
InterProIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERPTHR10464. PTHR10464. 1 hit.
PfamPF03253. UT. 1 hit.
[Graphical view]
PIRSFPIRSF016502. Urea_transporter. 1 hit.
ProtoNetSearch...

Other

NextBio20865519.

Entry information

Entry nameUT1_BOVIN
AccessionPrimary (citable) accession number: Q5QF96
Secondary accession number(s): Q2KJI0, Q2TM53
Entry history
Integrated into UniProtKB/Swiss-Prot: June 28, 2011
Last sequence update: January 4, 2005
Last modified: July 9, 2014
This is version 55 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

PDB cross-references

Index of Protein Data Bank (PDB) cross-references