Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Urea transporter 1

Gene

SLC14A1

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei334Important for channel permeability1

GO - Molecular functioni

  • urea channel activity Source: UniProtKB
  • water transmembrane transporter activity Source: Ensembl

GO - Biological processi

  • urea transmembrane transport Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiR-BTA-425366. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Names & Taxonomyi

Protein namesi
Recommended name:
Urea transporter 1
Alternative name(s):
Solute carrier family 14 member 1
Urea transporter B
Short name:
UT-B
Urea transporter, erythrocyte
Gene namesi
Name:SLC14A1
Synonyms:UT-B
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Chromosome 24

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Intramembranei47 – 64HelicalAdd BLAST18
Intramembranei68 – 83HelicalAdd BLAST16
Transmembranei86 – 105HelicalAdd BLAST20
Transmembranei110 – 132HelicalAdd BLAST23
Transmembranei139 – 163HelicalAdd BLAST25
Transmembranei168 – 188HelicalAdd BLAST21
Intramembranei215 – 229HelicalAdd BLAST15
Intramembranei234 – 245HelicalAdd BLAST12
Transmembranei250 – 269HelicalAdd BLAST20
Transmembranei279 – 299HelicalAdd BLAST21
Transmembranei304 – 325HelicalAdd BLAST22
Transmembranei328 – 348HelicalAdd BLAST21

GO - Cellular componenti

  • basolateral plasma membrane Source: UniProtKB-SubCell
  • integral component of plasma membrane Source: UniProtKB
  • nucleolus Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi172T → S: No effect on urea channel activity. 1 Publication1
Mutagenesisi334T → S: No effect on urea channel activity. 1 Publication1
Mutagenesisi334T → V: Nearly abolishes urea channel activity. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004109621 – 384Urea transporter 1Add BLAST384

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi206N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ5QF96.

Expressioni

Tissue specificityi

Isoform 1 and isoform 2 are expressed in kidney. Also expressed in the rumen (at protein level). Isoform 2 seems predominant in both tissues.1 Publication

Gene expression databases

BgeeiENSBTAG00000019870.

Interactioni

Subunit structurei

Identified in a complex with STOM (By similarity). Homotrimer; each subunit contains a pore through which urea permeates.By similarity1 Publication

Protein-protein interaction databases

DIPiDIP-60048N.
STRINGi9913.ENSBTAP00000044109.

Structurei

Secondary structure

1384
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi38 – 45Combined sources8
Helixi49 – 62Combined sources14
Helixi63 – 65Combined sources3
Helixi70 – 83Combined sources14
Helixi85 – 104Combined sources20
Helixi109 – 114Combined sources6
Turni115 – 118Combined sources4
Helixi119 – 130Combined sources12
Helixi139 – 141Combined sources3
Helixi142 – 163Combined sources22
Helixi164 – 166Combined sources3
Helixi173 – 186Combined sources14
Beta strandi191 – 193Combined sources3
Helixi209 – 211Combined sources3
Helixi214 – 226Combined sources13
Helixi227 – 229Combined sources3
Helixi234 – 247Combined sources14
Helixi249 – 268Combined sources20
Helixi273 – 277Combined sources5
Turni278 – 282Combined sources5
Helixi283 – 292Combined sources10
Turni293 – 295Combined sources3
Helixi301 – 326Combined sources26
Turni327 – 329Combined sources3
Helixi335 – 345Combined sources11
Helixi359 – 361Combined sources3
Helixi365 – 374Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4EZCX-ray2.36A/B/C1-384[»]
4EZDX-ray2.50A/B/C1-384[»]
ProteinModelPortaliQ5QF96.
SMRiQ5QF96.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the urea transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IEWG. Eukaryota.
COG4413. LUCA.
GeneTreeiENSGT00390000018729.
HOGENOMiHOG000065705.
HOVERGENiHBG000540.
InParanoidiQ5QF96.
KOiK08716.
OMAiMGGMFMA.
OrthoDBiEOG091G095L.
TreeFamiTF332858.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERiPTHR10464. PTHR10464. 1 hit.
PfamiPF03253. UT. 1 hit.
[Graphical view]
PIRSFiPIRSF016502. Urea_transporter. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5QF96-1) [UniParc]FASTAAdd to basket
Also known as: UT-B1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDDNPTAVKL DQGGNQAPQG RGRRCLPKAL GYITGDMKEF ANWLKDKPQA
60 70 80 90 100
LQFVDWVLRG ISQVVFVSNP ISGILILVGL LVQNPWCALN GCVGTVVSTL
110 120 130 140 150
TALLLSQDRS AITAGLQGYN ATLVGILMAI YSDKGNYFWW LLFPVSAMSM
160 170 180 190 200
TCPVFSSALN SVLSKWDLPV FTLPFNMALS MYLSATGHYN PFFPSTLITP
210 220 230 240 250
VTSVPNVTWP DLSALQLLKS LPVGVGQIYG CDNPWTGGIF LGAILLSSPL
260 270 280 290 300
MCLHAAIGSL LGIIAGLSLS APFEDIYAGL WGFNSSLACI AIGGTFMALT
310 320 330 340 350
WQTHLLALAC ALFTAYLGAS MSHVMAVVGL PSGTWPFCLA TLLFLLLTTK
360 370 380
NPNIYKMPIS KVTYPEENRI FYLQSRKRTV QGPL
Length:384
Mass (Da):41,473
Last modified:January 4, 2005 - v1
Checksum:i7AC8203F8A4E88A1
GO
Isoform 2 (identifier: Q5QF96-2) [UniParc]FASTAAdd to basket
Also known as: UT-B2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGRSLIGAAGDAYPGPLWRGPFGKKSGEAAHRVFPWINLAVVQGPEEQEPEETSM

Show »
Length:439
Mass (Da):47,334
Checksum:iB301A1BA65CCE8A2
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti54V → I in AAI05334 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0415751M → MSGRSLIGAAGDAYPGPLWR GPFGKKSGEAAHRVFPWINL AVVQGPEEQEPEETSM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY624602 mRNA. Translation: AAU94647.1.
AY838799 Genomic DNA. Translation: AAW02793.1.
AY838799 Genomic DNA. Translation: AAW51203.1.
BC105333 mRNA. Translation: AAI05334.1.
RefSeqiNP_001008666.1. NM_001008666.1. [Q5QF96-1]
XP_005224169.1. XM_005224112.3. [Q5QF96-2]
XP_005224170.1. XM_005224113.3. [Q5QF96-2]
XP_005224171.1. XM_005224114.3. [Q5QF96-2]
XP_005224173.1. XM_005224116.3. [Q5QF96-1]
XP_010817116.1. XM_010818814.2. [Q5QF96-1]
UniGeneiBt.66422.

Genome annotation databases

EnsembliENSBTAT00000026475; ENSBTAP00000026475; ENSBTAG00000019870. [Q5QF96-1]
ENSBTAT00000046861; ENSBTAP00000044109; ENSBTAG00000019870. [Q5QF96-1]
GeneIDi493988.
KEGGibta:493988.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY624602 mRNA. Translation: AAU94647.1.
AY838799 Genomic DNA. Translation: AAW02793.1.
AY838799 Genomic DNA. Translation: AAW51203.1.
BC105333 mRNA. Translation: AAI05334.1.
RefSeqiNP_001008666.1. NM_001008666.1. [Q5QF96-1]
XP_005224169.1. XM_005224112.3. [Q5QF96-2]
XP_005224170.1. XM_005224113.3. [Q5QF96-2]
XP_005224171.1. XM_005224114.3. [Q5QF96-2]
XP_005224173.1. XM_005224116.3. [Q5QF96-1]
XP_010817116.1. XM_010818814.2. [Q5QF96-1]
UniGeneiBt.66422.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4EZCX-ray2.36A/B/C1-384[»]
4EZDX-ray2.50A/B/C1-384[»]
ProteinModelPortaliQ5QF96.
SMRiQ5QF96.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-60048N.
STRINGi9913.ENSBTAP00000044109.

Proteomic databases

PaxDbiQ5QF96.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSBTAT00000026475; ENSBTAP00000026475; ENSBTAG00000019870. [Q5QF96-1]
ENSBTAT00000046861; ENSBTAP00000044109; ENSBTAG00000019870. [Q5QF96-1]
GeneIDi493988.
KEGGibta:493988.

Organism-specific databases

CTDi6563.

Phylogenomic databases

eggNOGiENOG410IEWG. Eukaryota.
COG4413. LUCA.
GeneTreeiENSGT00390000018729.
HOGENOMiHOG000065705.
HOVERGENiHBG000540.
InParanoidiQ5QF96.
KOiK08716.
OMAiMGGMFMA.
OrthoDBiEOG091G095L.
TreeFamiTF332858.

Enzyme and pathway databases

ReactomeiR-BTA-425366. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Gene expression databases

BgeeiENSBTAG00000019870.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERiPTHR10464. PTHR10464. 1 hit.
PfamiPF03253. UT. 1 hit.
[Graphical view]
PIRSFiPIRSF016502. Urea_transporter. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiUT1_BOVIN
AccessioniPrimary (citable) accession number: Q5QF96
Secondary accession number(s): Q2KJI0, Q2TM53
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 28, 2011
Last sequence update: January 4, 2005
Last modified: November 2, 2016
This is version 71 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.