Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5PT53

- NTCP7_MOUSE

UniProt

Q5PT53 - NTCP7_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sodium/bile acid cotransporter 7

Gene

Slc10a7

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. symporter activity Source: UniProtKB-KW

GO - Biological processi

  1. sodium ion transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Symport, Transport

Keywords - Ligandi

Sodium

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/bile acid cotransporter 7
Alternative name(s):
Na(+)/bile acid cotransporter 7
Solute carrier family 10 member 7
Gene namesi
Name:Slc10a7
Synonyms:P7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 8

Organism-specific databases

MGIiMGI:1924025. Slc10a7.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei11 – 3121HelicalSequence AnalysisAdd
BLAST
Transmembranei38 – 5821HelicalSequence AnalysisAdd
BLAST
Transmembranei72 – 9221HelicalSequence AnalysisAdd
BLAST
Transmembranei117 – 13721HelicalSequence AnalysisAdd
BLAST
Transmembranei139 – 15921HelicalSequence AnalysisAdd
BLAST
Transmembranei164 – 18421HelicalSequence AnalysisAdd
BLAST
Transmembranei202 – 22221HelicalSequence AnalysisAdd
BLAST
Transmembranei235 – 25521HelicalSequence AnalysisAdd
BLAST
Transmembranei271 – 29121HelicalSequence AnalysisAdd
BLAST
Transmembranei299 – 31921HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 340340Sodium/bile acid cotransporter 7PRO_0000278251Add
BLAST

Proteomic databases

PRIDEiQ5PT53.

PTM databases

PhosphoSiteiQ5PT53.

Expressioni

Gene expression databases

BgeeiQ5PT53.
GenevestigatoriQ5PT53.

Structurei

3D structure databases

ProteinModelPortaliQ5PT53.
SMRiQ5PT53. Positions 47-214.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0385.
GeneTreeiENSGT00390000011932.
HOGENOMiHOG000006888.
HOVERGENiHBG082064.
InParanoidiQ5PT53.
KOiK14347.
OMAiFYLCALP.
OrthoDBiEOG78H3TG.
PhylomeDBiQ5PT53.
TreeFamiTF329411.

Family and domain databases

InterProiIPR016833. Put_Na-Bile_cotransptr.
[Graphical view]
PANTHERiPTHR18640. PTHR18640. 1 hit.
PfamiPF13593. DUF4137. 1 hit.
[Graphical view]
PIRSFiPIRSF026166. UCP026166. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5PT53-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLLERARKE WFMVGIVVAI GAAKLEPSVG VNGGPLKPEI TVSYIAVATI
60 70 80 90 100
FFNSGLSLKT EELTSALVHL RLHLFIQIFT LAFFPAAIWL FLQLLSVTSI
110 120 130 140 150
NEWLLKGLQT VGCMPPPVSS AVILTKAVGG NEAAAIFNSA FGSFLGIVVT
160 170 180 190 200
PVLLLLFLGS SSSVPFTSIF SQLFMTVVVP LVIGQIVRRY IKDWLERKKP
210 220 230 240 250
PFGVVSSSVL LMIIYTTFCD TFSNPNIDLD KFSLILILFI IVSVQLSFML
260 270 280 290 300
LTFIFSTRNN SGFTPADTVA IIFCSTHKSL TLGIPMLKIV FAGHEHLSLI
310 320 330 340
SVPLLIYHPA QILLGSVLVP TIKSWMVSRQ KGVKLTRPTV
Length:340
Mass (Da):37,256
Last modified:January 4, 2005 - v1
Checksum:iE373F9E2F4848A5C
GO
Isoform 2 (identifier: Q5PT53-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     241-283: IVSVQLSFMLLTFIFSTRNNSGFTPADTVAIIFCSTHKSLTLG → R

Show »
Length:298
Mass (Da):32,750
Checksum:i4C1F9F22563BE1F6
GO
Isoform 3 (identifier: Q5PT53-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     158-185: Missing.

Show »
Length:312
Mass (Da):34,332
Checksum:i5CB5CE6967BD547F
GO

Sequence cautioni

The sequence BAC30613.1 differs from that shown. Reason: Erroneous termination at position 172. Translated as Gln.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti144 – 1441F → V in BAB27214. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei158 – 18528Missing in isoform 3. 1 PublicationVSP_023225Add
BLAST
Alternative sequencei241 – 28343IVSVQ…SLTLG → R in isoform 2. 1 PublicationVSP_023226Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY825926 mRNA. Translation: AAV80709.1.
AY825928 mRNA. Translation: AAV80711.1.
AK010834 mRNA. Translation: BAB27214.1.
AK040517 mRNA. Translation: BAC30613.1. Sequence problems.
AK079901 mRNA. Translation: BAC37779.1.
AK152752 mRNA. Translation: BAE31467.1.
AK152849 mRNA. Translation: BAE31542.1.
BC116666 mRNA. Translation: AAI16667.1.
BC116717 mRNA. Translation: AAI16718.1.
CCDSiCCDS40395.1. [Q5PT53-1]
RefSeqiNP_001009981.1. NM_001009981.2. [Q5PT53-3]
NP_001269037.1. NM_001282108.1. [Q5PT53-2]
NP_084012.1. NM_029736.2. [Q5PT53-1]
UniGeneiMm.334631.

Genome annotation databases

EnsembliENSMUST00000034111; ENSMUSP00000034111; ENSMUSG00000031684. [Q5PT53-1]
GeneIDi76775.
KEGGimmu:76775.
UCSCiuc009mid.1. mouse. [Q5PT53-1]
uc012ggi.1. mouse. [Q5PT53-3]
uc012ggk.1. mouse. [Q5PT53-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY825926 mRNA. Translation: AAV80709.1 .
AY825928 mRNA. Translation: AAV80711.1 .
AK010834 mRNA. Translation: BAB27214.1 .
AK040517 mRNA. Translation: BAC30613.1 . Sequence problems.
AK079901 mRNA. Translation: BAC37779.1 .
AK152752 mRNA. Translation: BAE31467.1 .
AK152849 mRNA. Translation: BAE31542.1 .
BC116666 mRNA. Translation: AAI16667.1 .
BC116717 mRNA. Translation: AAI16718.1 .
CCDSi CCDS40395.1. [Q5PT53-1 ]
RefSeqi NP_001009981.1. NM_001009981.2. [Q5PT53-3 ]
NP_001269037.1. NM_001282108.1. [Q5PT53-2 ]
NP_084012.1. NM_029736.2. [Q5PT53-1 ]
UniGenei Mm.334631.

3D structure databases

ProteinModelPortali Q5PT53.
SMRi Q5PT53. Positions 47-214.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q5PT53.

Proteomic databases

PRIDEi Q5PT53.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000034111 ; ENSMUSP00000034111 ; ENSMUSG00000031684 . [Q5PT53-1 ]
GeneIDi 76775.
KEGGi mmu:76775.
UCSCi uc009mid.1. mouse. [Q5PT53-1 ]
uc012ggi.1. mouse. [Q5PT53-3 ]
uc012ggk.1. mouse. [Q5PT53-2 ]

Organism-specific databases

CTDi 84068.
MGIi MGI:1924025. Slc10a7.

Phylogenomic databases

eggNOGi COG0385.
GeneTreei ENSGT00390000011932.
HOGENOMi HOG000006888.
HOVERGENi HBG082064.
InParanoidi Q5PT53.
KOi K14347.
OMAi FYLCALP.
OrthoDBi EOG78H3TG.
PhylomeDBi Q5PT53.
TreeFami TF329411.

Miscellaneous databases

NextBioi 345779.
PROi Q5PT53.
SOURCEi Search...

Gene expression databases

Bgeei Q5PT53.
Genevestigatori Q5PT53.

Family and domain databases

InterProi IPR016833. Put_Na-Bile_cotransptr.
[Graphical view ]
PANTHERi PTHR18640. PTHR18640. 1 hit.
Pfami PF13593. DUF4137. 1 hit.
[Graphical view ]
PIRSFi PIRSF026166. UCP026166. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Godoy J.R., Geyer J., Petzinger E.
    Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3).
    Strain: C57BL/6J.
    Tissue: Liver.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Bone marrow and Thymus.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

Entry informationi

Entry nameiNTCP7_MOUSE
AccessioniPrimary (citable) accession number: Q5PT53
Secondary accession number(s): Q5PT51
, Q8BV58, Q8BYD0, Q9CWD6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: January 4, 2005
Last modified: October 1, 2014
This is version 78 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3