Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/bile acid cotransporter 7

Gene

Slc10a7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Symport, Transport

Keywords - Ligandi

Sodium

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/bile acid cotransporter 7
Alternative name(s):
Na(+)/bile acid cotransporter 7
Solute carrier family 10 member 7
Gene namesi
Name:Slc10a7
Synonyms:P7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1924025. Slc10a7.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei11 – 31HelicalSequence analysisAdd BLAST21
Transmembranei38 – 58HelicalSequence analysisAdd BLAST21
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Transmembranei117 – 137HelicalSequence analysisAdd BLAST21
Transmembranei139 – 159HelicalSequence analysisAdd BLAST21
Transmembranei164 – 184HelicalSequence analysisAdd BLAST21
Transmembranei202 – 222HelicalSequence analysisAdd BLAST21
Transmembranei235 – 255HelicalSequence analysisAdd BLAST21
Transmembranei271 – 291HelicalSequence analysisAdd BLAST21
Transmembranei299 – 319HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002782511 – 340Sodium/bile acid cotransporter 7Add BLAST340

Proteomic databases

PaxDbiQ5PT53.
PRIDEiQ5PT53.

PTM databases

PhosphoSitePlusiQ5PT53.

Expressioni

Gene expression databases

BgeeiENSMUSG00000031684.
ExpressionAtlasiQ5PT53. baseline and differential.
GenevisibleiQ5PT53. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034111.

Structurei

3D structure databases

ProteinModelPortaliQ5PT53.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4821. Eukaryota.
COG0385. LUCA.
GeneTreeiENSGT00390000011932.
HOGENOMiHOG000006888.
HOVERGENiHBG082064.
InParanoidiQ5PT53.
KOiK14347.
OMAiFFFYGLK.
OrthoDBiEOG091G0GR7.
PhylomeDBiQ5PT53.
TreeFamiTF329411.

Family and domain databases

InterProiIPR016833. Put_Na-Bile_cotransptr.
[Graphical view]
PANTHERiPTHR18640. PTHR18640. 1 hit.
PfamiPF13593. SBF_like. 1 hit.
[Graphical view]
PIRSFiPIRSF026166. UCP026166. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5PT53-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLLERARKE WFMVGIVVAI GAAKLEPSVG VNGGPLKPEI TVSYIAVATI
60 70 80 90 100
FFNSGLSLKT EELTSALVHL RLHLFIQIFT LAFFPAAIWL FLQLLSVTSI
110 120 130 140 150
NEWLLKGLQT VGCMPPPVSS AVILTKAVGG NEAAAIFNSA FGSFLGIVVT
160 170 180 190 200
PVLLLLFLGS SSSVPFTSIF SQLFMTVVVP LVIGQIVRRY IKDWLERKKP
210 220 230 240 250
PFGVVSSSVL LMIIYTTFCD TFSNPNIDLD KFSLILILFI IVSVQLSFML
260 270 280 290 300
LTFIFSTRNN SGFTPADTVA IIFCSTHKSL TLGIPMLKIV FAGHEHLSLI
310 320 330 340
SVPLLIYHPA QILLGSVLVP TIKSWMVSRQ KGVKLTRPTV
Length:340
Mass (Da):37,256
Last modified:January 4, 2005 - v1
Checksum:iE373F9E2F4848A5C
GO
Isoform 2 (identifier: Q5PT53-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     241-283: IVSVQLSFMLLTFIFSTRNNSGFTPADTVAIIFCSTHKSLTLG → R

Show »
Length:298
Mass (Da):32,750
Checksum:i4C1F9F22563BE1F6
GO
Isoform 3 (identifier: Q5PT53-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     158-185: Missing.

Show »
Length:312
Mass (Da):34,332
Checksum:i5CB5CE6967BD547F
GO

Sequence cautioni

The sequence BAC30613 differs from that shown. Reason: Erroneous termination at position 172. Translated as Gln.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti144F → V in BAB27214 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_023225158 – 185Missing in isoform 3. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_023226241 – 283IVSVQ…SLTLG → R in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY825926 mRNA. Translation: AAV80709.1.
AY825928 mRNA. Translation: AAV80711.1.
AK010834 mRNA. Translation: BAB27214.1.
AK040517 mRNA. Translation: BAC30613.1. Sequence problems.
AK079901 mRNA. Translation: BAC37779.1.
AK152752 mRNA. Translation: BAE31467.1.
AK152849 mRNA. Translation: BAE31542.1.
BC116666 mRNA. Translation: AAI16667.1.
BC116717 mRNA. Translation: AAI16718.1.
CCDSiCCDS40395.1. [Q5PT53-1]
RefSeqiNP_001009981.1. NM_001009981.2. [Q5PT53-3]
NP_001269037.1. NM_001282108.1. [Q5PT53-2]
NP_084012.1. NM_029736.2. [Q5PT53-1]
UniGeneiMm.334631.

Genome annotation databases

EnsembliENSMUST00000034111; ENSMUSP00000034111; ENSMUSG00000031684. [Q5PT53-1]
ENSMUST00000209490; ENSMUSP00000148199; ENSMUSG00000031684. [Q5PT53-2]
ENSMUST00000209992; ENSMUSP00000147659; ENSMUSG00000031684. [Q5PT53-3]
ENSMUST00000211286; ENSMUSP00000147724; ENSMUSG00000031684. [Q5PT53-1]
GeneIDi76775.
KEGGimmu:76775.
UCSCiuc009mid.2. mouse. [Q5PT53-1]
uc012ggi.2. mouse. [Q5PT53-3]
uc012ggk.2. mouse. [Q5PT53-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY825926 mRNA. Translation: AAV80709.1.
AY825928 mRNA. Translation: AAV80711.1.
AK010834 mRNA. Translation: BAB27214.1.
AK040517 mRNA. Translation: BAC30613.1. Sequence problems.
AK079901 mRNA. Translation: BAC37779.1.
AK152752 mRNA. Translation: BAE31467.1.
AK152849 mRNA. Translation: BAE31542.1.
BC116666 mRNA. Translation: AAI16667.1.
BC116717 mRNA. Translation: AAI16718.1.
CCDSiCCDS40395.1. [Q5PT53-1]
RefSeqiNP_001009981.1. NM_001009981.2. [Q5PT53-3]
NP_001269037.1. NM_001282108.1. [Q5PT53-2]
NP_084012.1. NM_029736.2. [Q5PT53-1]
UniGeneiMm.334631.

3D structure databases

ProteinModelPortaliQ5PT53.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034111.

PTM databases

PhosphoSitePlusiQ5PT53.

Proteomic databases

PaxDbiQ5PT53.
PRIDEiQ5PT53.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034111; ENSMUSP00000034111; ENSMUSG00000031684. [Q5PT53-1]
ENSMUST00000209490; ENSMUSP00000148199; ENSMUSG00000031684. [Q5PT53-2]
ENSMUST00000209992; ENSMUSP00000147659; ENSMUSG00000031684. [Q5PT53-3]
ENSMUST00000211286; ENSMUSP00000147724; ENSMUSG00000031684. [Q5PT53-1]
GeneIDi76775.
KEGGimmu:76775.
UCSCiuc009mid.2. mouse. [Q5PT53-1]
uc012ggi.2. mouse. [Q5PT53-3]
uc012ggk.2. mouse. [Q5PT53-2]

Organism-specific databases

CTDi84068.
MGIiMGI:1924025. Slc10a7.

Phylogenomic databases

eggNOGiKOG4821. Eukaryota.
COG0385. LUCA.
GeneTreeiENSGT00390000011932.
HOGENOMiHOG000006888.
HOVERGENiHBG082064.
InParanoidiQ5PT53.
KOiK14347.
OMAiFFFYGLK.
OrthoDBiEOG091G0GR7.
PhylomeDBiQ5PT53.
TreeFamiTF329411.

Miscellaneous databases

PROiQ5PT53.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000031684.
ExpressionAtlasiQ5PT53. baseline and differential.
GenevisibleiQ5PT53. MM.

Family and domain databases

InterProiIPR016833. Put_Na-Bile_cotransptr.
[Graphical view]
PANTHERiPTHR18640. PTHR18640. 1 hit.
PfamiPF13593. SBF_like. 1 hit.
[Graphical view]
PIRSFiPIRSF026166. UCP026166. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiNTCP7_MOUSE
AccessioniPrimary (citable) accession number: Q5PT53
Secondary accession number(s): Q5PT51
, Q8BV58, Q8BYD0, Q9CWD6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: January 4, 2005
Last modified: November 30, 2016
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.