Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5PT53 (NTCP7_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 77. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sodium/bile acid cotransporter 7
Alternative name(s):
Na(+)/bile acid cotransporter 7
Solute carrier family 10 member 7
Gene names
Name:Slc10a7
Synonyms:P7
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length340 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Sequence similarities

Belongs to the unknown BART superfamily-1 (UBS1) (TC 2.A.93) family. [View classification]

Sequence caution

The sequence BAC30613.1 differs from that shown. Reason: Erroneous termination at position 172. Translated as Gln.

Ontologies

Keywords
   Biological processIon transport
Sodium transport
Symport
Transport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   LigandSodium
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processsodium ion transport

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functionsymporter activity

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5PT53-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5PT53-2)

The sequence of this isoform differs from the canonical sequence as follows:
     241-283: IVSVQLSFMLLTFIFSTRNNSGFTPADTVAIIFCSTHKSLTLG → R
Isoform 3 (identifier: Q5PT53-3)

The sequence of this isoform differs from the canonical sequence as follows:
     158-185: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 340340Sodium/bile acid cotransporter 7
PRO_0000278251

Regions

Transmembrane11 – 3121Helical; Potential
Transmembrane38 – 5821Helical; Potential
Transmembrane72 – 9221Helical; Potential
Transmembrane117 – 13721Helical; Potential
Transmembrane139 – 15921Helical; Potential
Transmembrane164 – 18421Helical; Potential
Transmembrane202 – 22221Helical; Potential
Transmembrane235 – 25521Helical; Potential
Transmembrane271 – 29121Helical; Potential
Transmembrane299 – 31921Helical; Potential

Natural variations

Alternative sequence158 – 18528Missing in isoform 3.
VSP_023225
Alternative sequence241 – 28343IVSVQ…SLTLG → R in isoform 2.
VSP_023226

Experimental info

Sequence conflict1441F → V in BAB27214. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 4, 2005. Version 1.
Checksum: E373F9E2F4848A5C

FASTA34037,256
        10         20         30         40         50         60 
MRLLERARKE WFMVGIVVAI GAAKLEPSVG VNGGPLKPEI TVSYIAVATI FFNSGLSLKT 

        70         80         90        100        110        120 
EELTSALVHL RLHLFIQIFT LAFFPAAIWL FLQLLSVTSI NEWLLKGLQT VGCMPPPVSS 

       130        140        150        160        170        180 
AVILTKAVGG NEAAAIFNSA FGSFLGIVVT PVLLLLFLGS SSSVPFTSIF SQLFMTVVVP 

       190        200        210        220        230        240 
LVIGQIVRRY IKDWLERKKP PFGVVSSSVL LMIIYTTFCD TFSNPNIDLD KFSLILILFI 

       250        260        270        280        290        300 
IVSVQLSFML LTFIFSTRNN SGFTPADTVA IIFCSTHKSL TLGIPMLKIV FAGHEHLSLI 

       310        320        330        340 
SVPLLIYHPA QILLGSVLVP TIKSWMVSRQ KGVKLTRPTV 

« Hide

Isoform 2 [UniParc].

Checksum: 4C1F9F22563BE1F6
Show »

FASTA29832,750
Isoform 3 [UniParc].

Checksum: 5CB5CE6967BD547F
Show »

FASTA31234,332

References

« Hide 'large scale' references
[1]Godoy J.R., Geyer J., Petzinger E.
Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3).
Strain: C57BL/6J.
Tissue: Liver.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: C57BL/6J.
Tissue: Bone marrow and Thymus.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY825926 mRNA. Translation: AAV80709.1.
AY825928 mRNA. Translation: AAV80711.1.
AK010834 mRNA. Translation: BAB27214.1.
AK040517 mRNA. Translation: BAC30613.1. Sequence problems.
AK079901 mRNA. Translation: BAC37779.1.
AK152752 mRNA. Translation: BAE31467.1.
AK152849 mRNA. Translation: BAE31542.1.
BC116666 mRNA. Translation: AAI16667.1.
BC116717 mRNA. Translation: AAI16718.1.
CCDSCCDS40395.1. [Q5PT53-1]
RefSeqNP_001009981.1. NM_001009981.2. [Q5PT53-3]
NP_001269037.1. NM_001282108.1. [Q5PT53-2]
NP_084012.1. NM_029736.2. [Q5PT53-1]
UniGeneMm.334631.

3D structure databases

ProteinModelPortalQ5PT53.
SMRQ5PT53. Positions 47-214.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ5PT53.

Proteomic databases

PRIDEQ5PT53.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000034111; ENSMUSP00000034111; ENSMUSG00000031684. [Q5PT53-1]
GeneID76775.
KEGGmmu:76775.
UCSCuc009mid.1. mouse. [Q5PT53-1]
uc012ggi.1. mouse. [Q5PT53-3]
uc012ggk.1. mouse. [Q5PT53-2]

Organism-specific databases

CTD84068.
MGIMGI:1924025. Slc10a7.

Phylogenomic databases

eggNOGCOG0385.
GeneTreeENSGT00390000011932.
HOGENOMHOG000006888.
HOVERGENHBG082064.
InParanoidQ5PT53.
KOK14347.
OMAFYLCALP.
OrthoDBEOG78H3TG.
PhylomeDBQ5PT53.
TreeFamTF329411.

Gene expression databases

BgeeQ5PT53.
GenevestigatorQ5PT53.

Family and domain databases

InterProIPR016833. Put_Na-Bile_cotransptr.
[Graphical view]
PANTHERPTHR18640. PTHR18640. 1 hit.
PfamPF13593. DUF4137. 1 hit.
[Graphical view]
PIRSFPIRSF026166. UCP026166. 1 hit.
ProtoNetSearch...

Other

NextBio345779.
PROQ5PT53.
SOURCESearch...

Entry information

Entry nameNTCP7_MOUSE
AccessionPrimary (citable) accession number: Q5PT53
Secondary accession number(s): Q5PT51 expand/collapse secondary AC list , Q8BV58, Q8BYD0, Q9CWD6
Entry history
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: January 4, 2005
Last modified: July 9, 2014
This is version 77 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot