Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/bile acid cotransporter 7

Gene

Slc10a7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Does not show transport activity towards bile acids or steroid sulfates (including taurocholate, cholate, chenodeoxycholate, estrone-3-sulfate, dehydroepiandrosterone sulfate (DHEAS) and pregnenolone sulfate).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processIon transport, Sodium transport, Symport, Transport
LigandSodium

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/bile acid cotransporter 7
Alternative name(s):
Na(+)/bile acid cotransporter 7
Solute carrier family 10 member 7
Gene namesi
Name:Slc10a7
Synonyms:P7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1924025 Slc10a7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 10CytoplasmicBy similarity10
Transmembranei11 – 31HelicalSequence analysisAdd BLAST21
Topological domaini32 – 37ExtracellularBy similarity6
Transmembranei38 – 58HelicalSequence analysisAdd BLAST21
Topological domaini59 – 71CytoplasmicBy similarityAdd BLAST13
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Topological domaini93 – 116ExtracellularBy similarityAdd BLAST24
Transmembranei117 – 137HelicalSequence analysisAdd BLAST21
Topological domaini138CytoplasmicBy similarity1
Transmembranei139 – 159HelicalSequence analysisAdd BLAST21
Topological domaini160 – 163ExtracellularBy similarity4
Transmembranei164 – 184HelicalSequence analysisAdd BLAST21
Topological domaini185 – 201CytoplasmicBy similarityAdd BLAST17
Transmembranei202 – 222HelicalSequence analysisAdd BLAST21
Topological domaini223 – 234ExtracellularBy similarityCuratedAdd BLAST12
Transmembranei235 – 255HelicalSequence analysisAdd BLAST21
Topological domaini256 – 270CytoplasmicBy similarityAdd BLAST15
Transmembranei271 – 291HelicalSequence analysisAdd BLAST21
Topological domaini292 – 298ExtracellularBy similarity7
Transmembranei299 – 319HelicalSequence analysisAdd BLAST21
Topological domaini320 – 340CytoplasmicBy similarityAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002782511 – 340Sodium/bile acid cotransporter 7Add BLAST340

Proteomic databases

PaxDbiQ5PT53
PRIDEiQ5PT53

PTM databases

PhosphoSitePlusiQ5PT53

Expressioni

Tissue specificityi

Expressed in heart, brain, colon, lung, liver, adrenal gland, stomach and ovary. Also expressed weakly in small intestine.1 Publication

Gene expression databases

BgeeiENSMUSG00000031684
ExpressionAtlasiQ5PT53 baseline and differential
GenevisibleiQ5PT53 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034111

Structurei

3D structure databases

ProteinModelPortaliQ5PT53
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4821 Eukaryota
COG0385 LUCA
GeneTreeiENSGT00390000011932
HOGENOMiHOG000006888
HOVERGENiHBG082064
InParanoidiQ5PT53
KOiK14347
OMAiFFFYGLK
OrthoDBiEOG091G0GR7
PhylomeDBiQ5PT53
TreeFamiTF329411

Family and domain databases

Gene3Di1.20.1530.20, 1 hit
InterProiView protein in InterPro
IPR038770 Na+/solute_symporter_sf
IPR016833 Put_Na-Bile_cotransptr
PANTHERiPTHR18640 PTHR18640, 1 hit
PfamiView protein in Pfam
PF13593 SBF_like, 1 hit
PIRSFiPIRSF026166 UCP026166, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5PT53-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLLERARKE WFMVGIVVAI GAAKLEPSVG VNGGPLKPEI TVSYIAVATI
60 70 80 90 100
FFNSGLSLKT EELTSALVHL RLHLFIQIFT LAFFPAAIWL FLQLLSVTSI
110 120 130 140 150
NEWLLKGLQT VGCMPPPVSS AVILTKAVGG NEAAAIFNSA FGSFLGIVVT
160 170 180 190 200
PVLLLLFLGS SSSVPFTSIF SQLFMTVVVP LVIGQIVRRY IKDWLERKKP
210 220 230 240 250
PFGVVSSSVL LMIIYTTFCD TFSNPNIDLD KFSLILILFI IVSVQLSFML
260 270 280 290 300
LTFIFSTRNN SGFTPADTVA IIFCSTHKSL TLGIPMLKIV FAGHEHLSLI
310 320 330 340
SVPLLIYHPA QILLGSVLVP TIKSWMVSRQ KGVKLTRPTV
Length:340
Mass (Da):37,256
Last modified:January 4, 2005 - v1
Checksum:iE373F9E2F4848A5C
GO
Isoform 2 (identifier: Q5PT53-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     241-283: IVSVQLSFMLLTFIFSTRNNSGFTPADTVAIIFCSTHKSLTLG → R

Show »
Length:298
Mass (Da):32,750
Checksum:i4C1F9F22563BE1F6
GO
Isoform 3 (identifier: Q5PT53-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     158-185: Missing.

Show »
Length:312
Mass (Da):34,332
Checksum:i5CB5CE6967BD547F
GO

Sequence cautioni

The sequence BAC30613 differs from that shown. Reason: Erroneous termination at position 172. Translated as Gln.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti144F → V in BAB27214 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_023225158 – 185Missing in isoform 3. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_023226241 – 283IVSVQ…SLTLG → R in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY825926 mRNA Translation: AAV80709.1
AY825928 mRNA Translation: AAV80711.1
AK010834 mRNA Translation: BAB27214.1
AK040517 mRNA Translation: BAC30613.1 Sequence problems.
AK079901 mRNA Translation: BAC37779.1
AK152752 mRNA Translation: BAE31467.1
AK152849 mRNA Translation: BAE31542.1
BC116666 mRNA Translation: AAI16667.1
BC116717 mRNA Translation: AAI16718.1
CCDSiCCDS40395.1 [Q5PT53-1]
CCDS85567.1 [Q5PT53-2]
CCDS85568.1 [Q5PT53-3]
RefSeqiNP_001009981.1, NM_001009981.2 [Q5PT53-3]
NP_001269037.1, NM_001282108.1 [Q5PT53-2]
NP_084012.1, NM_029736.2 [Q5PT53-1]
UniGeneiMm.334631

Genome annotation databases

EnsembliENSMUST00000034111; ENSMUSP00000034111; ENSMUSG00000031684 [Q5PT53-1]
ENSMUST00000209490; ENSMUSP00000148199; ENSMUSG00000031684 [Q5PT53-2]
ENSMUST00000209992; ENSMUSP00000147659; ENSMUSG00000031684 [Q5PT53-3]
ENSMUST00000211286; ENSMUSP00000147724; ENSMUSG00000031684 [Q5PT53-1]
GeneIDi76775
KEGGimmu:76775
UCSCiuc009mid.2 mouse [Q5PT53-1]
uc012ggi.2 mouse [Q5PT53-3]
uc012ggk.2 mouse [Q5PT53-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNTCP7_MOUSE
AccessioniPrimary (citable) accession number: Q5PT53
Secondary accession number(s): Q5PT51
, Q8BV58, Q8BYD0, Q9CWD6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: January 4, 2005
Last modified: May 23, 2018
This is version 96 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health