Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5PQX1 (TOIP1_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 75. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Torsin-1A-interacting protein 1
Alternative name(s):
Lamina-associated polypeptide 1B
Short name=LAP1B
Lamina-associated polypeptide 1C
Short name=LAP1C
Gene names
Name:Tor1aip1
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length583 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Binds to A- and B-type lamins. Possible role in membrane attachment and assembly of the nuclear lamina. Induces TOR1A and TOR1B ATPase activity.

Subunit structure

Interacts with ATP1B4. Interacts with TOR1A (ATP-bound). Ref.4

Subcellular location

Nucleus inner membrane; Single-pass membrane protein Ref.1 Ref.3.

Sequence similarities

Belongs to the TOR1AIP family.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 Ref.2 (identifier: Q5PQX1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 Ref.1 (identifier: Q5PQX1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     220-246: Missing.
     362-412: TTAVQEFQNQMKQLQSKYQSQDEKLWKRGTTFLEKHLNSSLPRPQPAILLL → I
Isoform 3 Ref.1 (identifier: Q5PQX1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-121: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 583583Torsin-1A-interacting protein 1
PRO_0000084355

Regions

Topological domain1 – 339339Nuclear Potential
Transmembrane340 – 36021Helical; Potential
Topological domain361 – 583223Perinuclear space Potential
Region356 – 583228Interaction with TOR1A By similarity
Coiled coil360 – 38829 Potential

Amino acid modifications

Modified residue1341Phosphoserine By similarity
Modified residue1421Phosphoserine By similarity
Modified residue1551Phosphoserine By similarity
Modified residue1891Phosphoserine By similarity
Modified residue2221Phosphothreonine By similarity
Modified residue2281Phosphoserine By similarity
Modified residue3161Phosphoserine By similarity

Natural variations

Alternative sequence1 – 121121Missing in isoform 3. Ref.1
VSP_051776
Alternative sequence220 – 24627Missing in isoform 2. Ref.1
VSP_051777
Alternative sequence362 – 41251TTAVQ…AILLL → I in isoform 2. Ref.1
VSP_051778

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 4, 2005. Version 1.
Checksum: 827FC3FA8CBDE3D8

FASTA58365,649
        10         20         30         40         50         60 
MAGERWRAEG LGEGWAIYVT PRAPIREGRR RLATQNGDGS DAPAYETHPS RHGRREVRFS 

        70         80         90        100        110        120 
EEPPEVYGDF EPRAAKERSP GERRTPPEKF RSDSAKEEVR ESAYNLRSRQ RRQRGPQEAE 

       130        140        150        160        170        180 
EMKTRRSTRL EQHSQQAQQQ LSPATSGRGL RDAQSLSEDR GEDEPSSQPV TSQTVSKKTV 

       190        200        210        220        230        240 
RTPETSVMSE DPISNLCRPP LRSPRPDASI VQHINPFEEG ETEDDLESSY SDVTIRIRSR 

       250        260        270        280        290        300 
DSVESRDEAA VAAGHHPDSL WGLPHSRGDF TAHENQPSLL PTGCQKNPQE WVEQAVRMRT 

       310        320        330        340        350        360 
RMAYNNIQKS DFGNQSPSTS RQQAAVQPPD ESSVKIKWWL LILVAALAMG IYWFFHTPVV 

       370        380        390        400        410        420 
ETTAVQEFQN QMKQLQSKYQ SQDEKLWKRG TTFLEKHLNS SLPRPQPAIL LLTAAQDAAE 

       430        440        450        460        470        480 
VLKCLSEQIA DAYSSFRSVR AIRIDGAGKA AQDSDLVKHE VDQELTDGFR NGQNAAVVHR 

       490        500        510        520        530        540 
FESLPAGSTL IFYKYCDHEN AAFKDVALVL TVLLEEQTLE ASLGLKEIEE KVRDFLKVKF 

       550        560        570        580 
TSSDTANSYN HMDPDKLNGL WSRISHLVLP VQPENALKAG SCL 

« Hide

Isoform 2 [UniParc].

Checksum: 1A59296053E0A243
Show »

FASTA50656,696
Isoform 3 [UniParc].

Checksum: D65027BF8EAC42B9
Show »

FASTA46251,690

References

« Hide 'large scale' references
[1]"cDNA cloning and characterization of lamina-associated polypeptide 1C (LAP1C), an integral protein of the inner nuclear membrane."
Martin L., Crimaudo C., Gerace L.
J. Biol. Chem. 270:8822-8828(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), SUBCELLULAR LOCATION.
Strain: Sprague-Dawley.
Tissue: Liver.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Kidney.
[3]"Proteome analysis of a rat liver nuclear insoluble protein fraction and localization of a novel protein, ISP36, to compartments in the interchromatin space."
Segawa M., Niino K., Mineki R., Kaga N., Murayama K., Sugimoto K., Watanabe Y., Furukawa K., Horigome T.
FEBS J. 272:4327-4338(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 32-39 AND 152-160, SUBCELLULAR LOCATION.
Tissue: Liver.
[4]"Accumulation of beta (m), a structural member of X,K-ATPase beta-subunit family, in nuclear envelopes of perinatal myocytes."
Zhao H., Pestov N.B., Korneenko T.V., Shakhparonov M.I., Modyanov N.N.
Am. J. Physiol. 286:C757-C767(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH ATP1B4.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U19614 mRNA. Translation: AAA69914.1.
U20286 mRNA. Translation: AAA69915.1.
BC086987 mRNA. Translation: AAH86987.1.
PIRA56391.
I61730.
RefSeqNP_659560.2. NM_145092.2.
XP_006250088.1. XM_006250026.1.
UniGeneRn.11373.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

MINTMINT-4997163.

PTM databases

PhosphoSiteQ5PQX1.

Proteomic databases

PaxDbQ5PQX1.
PRIDEQ5PQX1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSRNOT00000005280; ENSRNOP00000005280; ENSRNOG00000003946. [Q5PQX1-1]
GeneID246314.
KEGGrno:246314.
UCSCRGD:628851. rat. [Q5PQX1-1]

Organism-specific databases

CTD26092.
RGD628851. Tor1aip1.

Phylogenomic databases

eggNOGNOG40503.
GeneTreeENSGT00390000012166.
HOGENOMHOG000015293.
HOVERGENHBG083152.
InParanoidQ5PQX1.
OMANSYKHMD.
OrthoDBEOG7G7KQH.

Gene expression databases

ArrayExpressQ5PQX1.
GenevestigatorQ5PQX1.

Family and domain databases

InterProIPR008662. Lamina-ass_polypeptide_CLAP1C.
[Graphical view]
PfamPF05609. LAP1C. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio623740.
PROQ5PQX1.

Entry information

Entry nameTOIP1_RAT
AccessionPrimary (citable) accession number: Q5PQX1
Secondary accession number(s): Q62741, Q62754
Entry history
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: January 4, 2005
Last modified: April 16, 2014
This is version 75 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families