Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Torsin-1A-interacting protein 1

Gene

Tor1aip1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for nuclear membrane integrity. Induces TOR1A and TOR1B ATPase activity and is required for their location on the nuclear membrane. Binds to A- and B-type lamins. Possible role in membrane attachment and assembly of the nuclear lamina.

GO - Molecular functioni

  • ATPase activator activity Source: UniProtKB
  • lamin binding Source: RGD

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Torsin-1A-interacting protein 1
Alternative name(s):
Lamina-associated polypeptide 1B
Short name:
LAP1B
Lamina-associated polypeptide 1C
Short name:
LAP1C
Gene namesi
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 13

Organism-specific databases

RGDi628851. Tor1aip1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 339Nuclear1 PublicationSequence analysisAdd BLAST339
Transmembranei340 – 360HelicalSequence analysisAdd BLAST21
Topological domaini361 – 583Perinuclear spaceSequence analysisAdd BLAST223

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • nuclear envelope Source: RGD
  • nuclear inner membrane Source: UniProtKB-SubCell
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000843551 – 583Torsin-1A-interacting protein 1Add BLAST583

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei60PhosphoserineCombined sources1
Modified residuei134PhosphoserineBy similarity1
Modified residuei142PhosphoserineCombined sources1
Modified residuei155PhosphoserineBy similarity1
Modified residuei157PhosphoserineCombined sources1
Modified residuei189PhosphoserineBy similarity1
Modified residuei222PhosphothreonineBy similarity1
Modified residuei228PhosphoserineBy similarity1
Modified residuei231PhosphoserineCombined sources1
Modified residuei242PhosphoserineCombined sources1
Modified residuei316PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ5PQX1.
PRIDEiQ5PQX1.

PTM databases

iPTMnetiQ5PQX1.
PhosphoSitePlusiQ5PQX1.

Expressioni

Gene expression databases

BgeeiENSRNOG00000003946.
ExpressionAtlasiQ5PQX1. baseline and differential.
GenevisibleiQ5PQX1. RN.

Interactioni

Subunit structurei

Interacts with ATP1B4. Interacts with TOR1A (ATP-bound). Interacts with TOR1B, TOR2A and TOR3A. Interacts with VIM.1 Publication

GO - Molecular functioni

  • lamin binding Source: RGD

Protein-protein interaction databases

DIPiDIP-60963N.
MINTiMINT-4997163.
STRINGi10116.ENSRNOP00000005280.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni356 – 583Interaction with TOR1ABy similarityAdd BLAST228

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili360 – 388Sequence analysisAdd BLAST29

Sequence similaritiesi

Belongs to the TOR1AIP family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJUB. Eukaryota.
ENOG4111IZJ. LUCA.
GeneTreeiENSGT00390000012166.
HOGENOMiHOG000015293.
HOVERGENiHBG083152.
InParanoidiQ5PQX1.
OMAiTAVQEFQ.

Family and domain databases

InterProiIPR008662. Lamina-ass_polypeptide_CLAP1C.
[Graphical view]
PfamiPF05609. LAP1C. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5PQX1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGERWRAEG LGEGWAIYVT PRAPIREGRR RLATQNGDGS DAPAYETHPS
60 70 80 90 100
RHGRREVRFS EEPPEVYGDF EPRAAKERSP GERRTPPEKF RSDSAKEEVR
110 120 130 140 150
ESAYNLRSRQ RRQRGPQEAE EMKTRRSTRL EQHSQQAQQQ LSPATSGRGL
160 170 180 190 200
RDAQSLSEDR GEDEPSSQPV TSQTVSKKTV RTPETSVMSE DPISNLCRPP
210 220 230 240 250
LRSPRPDASI VQHINPFEEG ETEDDLESSY SDVTIRIRSR DSVESRDEAA
260 270 280 290 300
VAAGHHPDSL WGLPHSRGDF TAHENQPSLL PTGCQKNPQE WVEQAVRMRT
310 320 330 340 350
RMAYNNIQKS DFGNQSPSTS RQQAAVQPPD ESSVKIKWWL LILVAALAMG
360 370 380 390 400
IYWFFHTPVV ETTAVQEFQN QMKQLQSKYQ SQDEKLWKRG TTFLEKHLNS
410 420 430 440 450
SLPRPQPAIL LLTAAQDAAE VLKCLSEQIA DAYSSFRSVR AIRIDGAGKA
460 470 480 490 500
AQDSDLVKHE VDQELTDGFR NGQNAAVVHR FESLPAGSTL IFYKYCDHEN
510 520 530 540 550
AAFKDVALVL TVLLEEQTLE ASLGLKEIEE KVRDFLKVKF TSSDTANSYN
560 570 580
HMDPDKLNGL WSRISHLVLP VQPENALKAG SCL
Length:583
Mass (Da):65,649
Last modified:January 4, 2005 - v1
Checksum:i827FC3FA8CBDE3D8
GO
Isoform 21 Publication (identifier: Q5PQX1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-246: Missing.
     362-412: TTAVQEFQNQMKQLQSKYQSQDEKLWKRGTTFLEKHLNSSLPRPQPAILLL → I

Show »
Length:506
Mass (Da):56,696
Checksum:i1A59296053E0A243
GO
Isoform 31 Publication (identifier: Q5PQX1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-121: Missing.

Show »
Length:462
Mass (Da):51,690
Checksum:iD65027BF8EAC42B9
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0517761 – 121Missing in isoform 3. 1 PublicationAdd BLAST121
Alternative sequenceiVSP_051777220 – 246Missing in isoform 2. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_051778362 – 412TTAVQ…AILLL → I in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U19614 mRNA. Translation: AAA69914.1.
U20286 mRNA. Translation: AAA69915.1.
BC086987 mRNA. Translation: AAH86987.1.
PIRiA56391.
I61730.
RefSeqiNP_659560.2. NM_145092.2. [Q5PQX1-1]
UniGeneiRn.11373.

Genome annotation databases

EnsembliENSRNOT00000005280; ENSRNOP00000005280; ENSRNOG00000003946. [Q5PQX1-1]
ENSRNOT00000005296; ENSRNOP00000005296; ENSRNOG00000003946. [Q5PQX1-1]
GeneIDi246314.
KEGGirno:246314.
UCSCiRGD:628851. rat. [Q5PQX1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U19614 mRNA. Translation: AAA69914.1.
U20286 mRNA. Translation: AAA69915.1.
BC086987 mRNA. Translation: AAH86987.1.
PIRiA56391.
I61730.
RefSeqiNP_659560.2. NM_145092.2. [Q5PQX1-1]
UniGeneiRn.11373.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-60963N.
MINTiMINT-4997163.
STRINGi10116.ENSRNOP00000005280.

PTM databases

iPTMnetiQ5PQX1.
PhosphoSitePlusiQ5PQX1.

Proteomic databases

PaxDbiQ5PQX1.
PRIDEiQ5PQX1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000005280; ENSRNOP00000005280; ENSRNOG00000003946. [Q5PQX1-1]
ENSRNOT00000005296; ENSRNOP00000005296; ENSRNOG00000003946. [Q5PQX1-1]
GeneIDi246314.
KEGGirno:246314.
UCSCiRGD:628851. rat. [Q5PQX1-1]

Organism-specific databases

CTDi26092.
RGDi628851. Tor1aip1.

Phylogenomic databases

eggNOGiENOG410IJUB. Eukaryota.
ENOG4111IZJ. LUCA.
GeneTreeiENSGT00390000012166.
HOGENOMiHOG000015293.
HOVERGENiHBG083152.
InParanoidiQ5PQX1.
OMAiTAVQEFQ.

Miscellaneous databases

PROiQ5PQX1.

Gene expression databases

BgeeiENSRNOG00000003946.
ExpressionAtlasiQ5PQX1. baseline and differential.
GenevisibleiQ5PQX1. RN.

Family and domain databases

InterProiIPR008662. Lamina-ass_polypeptide_CLAP1C.
[Graphical view]
PfamiPF05609. LAP1C. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTOIP1_RAT
AccessioniPrimary (citable) accession number: Q5PQX1
Secondary accession number(s): Q62741, Q62754
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: January 4, 2005
Last modified: November 2, 2016
This is version 90 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.