SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5PQX1

- TOIP1_RAT

UniProt

Q5PQX1 - TOIP1_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Torsin-1A-interacting protein 1
Gene
Tor1aip1
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Required for nuclear membrane integrity. Induces TOR1A and TOR1B ATPase activity and is required for their location on the nuclear membrane. Binds to A- and B-type lamins. Possible role in membrane attachment and assembly of the nuclear lamina.

GO - Molecular functioni

  1. ATPase activator activity Source: UniProtKB
  2. lamin binding Source: RGD
  3. protein binding Source: UniProtKB

GO - Biological processi

  1. nuclear membrane organization Source: Ensembl
  2. positive regulation of ATPase activity Source: UniProtKB
  3. protein localization to nucleus Source: Ensembl
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Torsin-1A-interacting protein 1
Alternative name(s):
Lamina-associated polypeptide 1B
Short name:
LAP1B
Lamina-associated polypeptide 1C
Short name:
LAP1C
Gene namesi
Name:Tor1aip1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 13

Organism-specific databases

RGDi628851. Tor1aip1.

Subcellular locationi

Nucleus inner membrane; Single-pass membrane protein 2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 339339Nuclear Reviewed prediction
Add
BLAST
Transmembranei340 – 36021Helical; Reviewed prediction
Add
BLAST
Topological domaini361 – 583223Perinuclear space Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. nuclear envelope Source: RGD
  3. nuclear inner membrane Source: UniProtKB-SubCell
  4. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 583583Torsin-1A-interacting protein 1
PRO_0000084355Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei134 – 1341Phosphoserine By similarity
Modified residuei142 – 1421Phosphoserine By similarity
Modified residuei155 – 1551Phosphoserine By similarity
Modified residuei189 – 1891Phosphoserine By similarity
Modified residuei222 – 2221Phosphothreonine By similarity
Modified residuei228 – 2281Phosphoserine By similarity
Modified residuei316 – 3161Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ5PQX1.
PRIDEiQ5PQX1.

PTM databases

PhosphoSiteiQ5PQX1.

Expressioni

Gene expression databases

ArrayExpressiQ5PQX1.
GenevestigatoriQ5PQX1.

Interactioni

Subunit structurei

Interacts with ATP1B4. Interacts with TOR1A (ATP-bound). Interacts with TOR1B, TOR2A and TOR3A. Interacts with VIM.1 Publication

Protein-protein interaction databases

MINTiMINT-4997163.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni356 – 583228Interaction with TOR1A By similarity
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili360 – 38829 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Belongs to the TOR1AIP family.

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG40503.
GeneTreeiENSGT00390000012166.
HOGENOMiHOG000015293.
HOVERGENiHBG083152.
InParanoidiQ5PQX1.
OMAiNSYKHMD.
OrthoDBiEOG7G7KQH.

Family and domain databases

InterProiIPR008662. Lamina-ass_polypeptide_CLAP1C.
[Graphical view]
PfamiPF05609. LAP1C. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 11 Publication (identifier: Q5PQX1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAGERWRAEG LGEGWAIYVT PRAPIREGRR RLATQNGDGS DAPAYETHPS    50
RHGRREVRFS EEPPEVYGDF EPRAAKERSP GERRTPPEKF RSDSAKEEVR 100
ESAYNLRSRQ RRQRGPQEAE EMKTRRSTRL EQHSQQAQQQ LSPATSGRGL 150
RDAQSLSEDR GEDEPSSQPV TSQTVSKKTV RTPETSVMSE DPISNLCRPP 200
LRSPRPDASI VQHINPFEEG ETEDDLESSY SDVTIRIRSR DSVESRDEAA 250
VAAGHHPDSL WGLPHSRGDF TAHENQPSLL PTGCQKNPQE WVEQAVRMRT 300
RMAYNNIQKS DFGNQSPSTS RQQAAVQPPD ESSVKIKWWL LILVAALAMG 350
IYWFFHTPVV ETTAVQEFQN QMKQLQSKYQ SQDEKLWKRG TTFLEKHLNS 400
SLPRPQPAIL LLTAAQDAAE VLKCLSEQIA DAYSSFRSVR AIRIDGAGKA 450
AQDSDLVKHE VDQELTDGFR NGQNAAVVHR FESLPAGSTL IFYKYCDHEN 500
AAFKDVALVL TVLLEEQTLE ASLGLKEIEE KVRDFLKVKF TSSDTANSYN 550
HMDPDKLNGL WSRISHLVLP VQPENALKAG SCL 583
Length:583
Mass (Da):65,649
Last modified:January 4, 2005 - v1
Checksum:i827FC3FA8CBDE3D8
GO
Isoform 21 Publication (identifier: Q5PQX1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-246: Missing.
     362-412: TTAVQEFQNQMKQLQSKYQSQDEKLWKRGTTFLEKHLNSSLPRPQPAILLL → I

Show »
Length:506
Mass (Da):56,696
Checksum:i1A59296053E0A243
GO
Isoform 31 Publication (identifier: Q5PQX1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-121: Missing.

Show »
Length:462
Mass (Da):51,690
Checksum:iD65027BF8EAC42B9
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 121121Missing in isoform 3. 1 Publication
VSP_051776Add
BLAST
Alternative sequencei220 – 24627Missing in isoform 2. 1 Publication
VSP_051777Add
BLAST
Alternative sequencei362 – 41251TTAVQ…AILLL → I in isoform 2. 1 Publication
VSP_051778Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U19614 mRNA. Translation: AAA69914.1.
U20286 mRNA. Translation: AAA69915.1.
BC086987 mRNA. Translation: AAH86987.1.
PIRiA56391.
I61730.
RefSeqiNP_659560.2. NM_145092.2. [Q5PQX1-1]
XP_006250088.1. XM_006250026.1. [Q5PQX1-1]
UniGeneiRn.11373.

Genome annotation databases

EnsembliENSRNOT00000005280; ENSRNOP00000005280; ENSRNOG00000003946. [Q5PQX1-1]
GeneIDi246314.
KEGGirno:246314.
UCSCiRGD:628851. rat. [Q5PQX1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U19614 mRNA. Translation: AAA69914.1 .
U20286 mRNA. Translation: AAA69915.1 .
BC086987 mRNA. Translation: AAH86987.1 .
PIRi A56391.
I61730.
RefSeqi NP_659560.2. NM_145092.2. [Q5PQX1-1 ]
XP_006250088.1. XM_006250026.1. [Q5PQX1-1 ]
UniGenei Rn.11373.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

MINTi MINT-4997163.

PTM databases

PhosphoSitei Q5PQX1.

Proteomic databases

PaxDbi Q5PQX1.
PRIDEi Q5PQX1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000005280 ; ENSRNOP00000005280 ; ENSRNOG00000003946 . [Q5PQX1-1 ]
GeneIDi 246314.
KEGGi rno:246314.
UCSCi RGD:628851. rat. [Q5PQX1-1 ]

Organism-specific databases

CTDi 26092.
RGDi 628851. Tor1aip1.

Phylogenomic databases

eggNOGi NOG40503.
GeneTreei ENSGT00390000012166.
HOGENOMi HOG000015293.
HOVERGENi HBG083152.
InParanoidi Q5PQX1.
OMAi NSYKHMD.
OrthoDBi EOG7G7KQH.

Miscellaneous databases

NextBioi 623740.
PROi Q5PQX1.

Gene expression databases

ArrayExpressi Q5PQX1.
Genevestigatori Q5PQX1.

Family and domain databases

InterProi IPR008662. Lamina-ass_polypeptide_CLAP1C.
[Graphical view ]
Pfami PF05609. LAP1C. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "cDNA cloning and characterization of lamina-associated polypeptide 1C (LAP1C), an integral protein of the inner nuclear membrane."
    Martin L., Crimaudo C., Gerace L.
    J. Biol. Chem. 270:8822-8828(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), SUBCELLULAR LOCATION.
    Strain: Sprague-Dawley.
    Tissue: Liver.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney.
  3. "Proteome analysis of a rat liver nuclear insoluble protein fraction and localization of a novel protein, ISP36, to compartments in the interchromatin space."
    Segawa M., Niino K., Mineki R., Kaga N., Murayama K., Sugimoto K., Watanabe Y., Furukawa K., Horigome T.
    FEBS J. 272:4327-4338(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 32-39 AND 152-160, SUBCELLULAR LOCATION.
    Tissue: Liver.
  4. "Accumulation of beta (m), a structural member of X,K-ATPase beta-subunit family, in nuclear envelopes of perinatal myocytes."
    Zhao H., Pestov N.B., Korneenko T.V., Shakhparonov M.I., Modyanov N.N.
    Am. J. Physiol. 286:C757-C767(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ATP1B4.

Entry informationi

Entry nameiTOIP1_RAT
AccessioniPrimary (citable) accession number: Q5PQX1
Secondary accession number(s): Q62741, Q62754
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: January 4, 2005
Last modified: June 11, 2014
This is version 77 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi