Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein cordon-bleu

Gene

Cobl

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays an important role in the reorganization of the actin cytoskeleton. Binds to and sequesters actin monomers (G actin). Nucleates actin polymerization by assembling three actin monomers in cross-filament orientation and thereby promotes growth of actin filaments at the barbed end. Can also mediate actin depolymerization at barbed ends and severing of actin filaments. Promotes formation of cell ruffles. Regulates neuron morphogenesis and increases branching of axons and dendrites. Regulates dendrite branching in Purkinje cells.2 Publications

GO - Molecular functioni

  • actin monomer binding Source: BHF-UCL

GO - Biological processi

  • actin crosslink formation Source: BHF-UCL
  • actin filament network formation Source: BHF-UCL
  • actin filament polymerization Source: BHF-UCL
  • collateral sprouting in absence of injury Source: BHF-UCL
  • digestive tract development Source: BHF-UCL
  • embryonic axis specification Source: BHF-UCL
  • floor plate development Source: BHF-UCL
  • liver development Source: BHF-UCL
  • neural tube closure Source: MGI
  • notochord development Source: BHF-UCL
  • positive regulation of dendrite development Source: BHF-UCL
  • positive regulation of ruffle assembly Source: BHF-UCL
  • somite specification Source: BHF-UCL
Complete GO annotation...

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein cordon-bleu
Gene namesi
Name:Cobl
Synonyms:Kiaa0633
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:105056. Cobl.

Subcellular locationi

GO - Cellular componenti

  • axon Source: BHF-UCL
  • axonal growth cone Source: BHF-UCL
  • cell cortex Source: BHF-UCL
  • cytoskeleton Source: UniProtKB-SubCell
  • dendrite Source: BHF-UCL
  • dendritic growth cone Source: BHF-UCL
  • neuronal cell body Source: BHF-UCL
  • perinuclear region of cytoplasm Source: BHF-UCL
  • plasma membrane Source: UniProtKB-SubCell
  • ruffle Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13371337Protein cordon-bleuPRO_0000260492Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei47 – 471PhosphoserineCombined sources
Modified residuei50 – 501PhosphoserineCombined sources
Modified residuei212 – 2121PhosphoserineBy similarity
Modified residuei235 – 2351PhosphoserineBy similarity
Modified residuei272 – 2721PhosphoserineCombined sources
Modified residuei294 – 2941PhosphoserineBy similarity
Modified residuei346 – 3461PhosphoserineBy similarity
Modified residuei349 – 3491PhosphoserineBy similarity
Modified residuei372 – 3721PhosphoserineBy similarity
Modified residuei522 – 5221PhosphothreonineCombined sources
Modified residuei649 – 6491PhosphoserineBy similarity
Modified residuei816 – 8161PhosphoserineBy similarity
Modified residuei1038 – 10381PhosphoserineBy similarity
Modified residuei1128 – 11281PhosphoserineCombined sources
Modified residuei1303 – 13031PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ5NBX1.
PaxDbiQ5NBX1.
PeptideAtlasiQ5NBX1.
PRIDEiQ5NBX1.

PTM databases

iPTMnetiQ5NBX1.
PhosphoSiteiQ5NBX1.

Expressioni

Tissue specificityi

Detected in brain cortex and in the Purkinje cell layer in the cerebellum. Detected in hippocampus neurons, and at lower levels in testis, lung and spleen (at protein level). Detected in embryonic neural tube.4 Publications

Gene expression databases

BgeeiENSMUSG00000020173.
CleanExiMM_COBL.
ExpressionAtlasiQ5NBX1. baseline and differential.
GenevisibleiQ5NBX1. MM.

Interactioni

Subunit structurei

Identified in a complex composed of COBL, PACSIN1 and WASL. Interacts with PACSIN1, PACSIN2 and PACSIN3 (By similarity). Identified in a complex composed of ACTA1, COBL, GSN AND TMSB4X. Interacts (via WH2 domains) with actin monomers. Interacts with DBNL.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Pacsin1Q9Z0W514EBI-1550138,EBI-1550185From a different organism.
Pacsin2Q9QY174EBI-1550138,EBI-491201From a different organism.
Pacsin3Q5I2Z03EBI-1550138,EBI-7003023From a different organism.

GO - Molecular functioni

  • actin monomer binding Source: BHF-UCL

Protein-protein interaction databases

DIPiDIP-39834N.
IntActiQ5NBX1. 5 interactions.
MINTiMINT-8244298.
STRINGi10090.ENSMUSP00000045693.

Structurei

Secondary structure

1
1337
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi1185 – 119410Combined sources
Turni1195 – 11973Combined sources
Beta strandi1202 – 12054Combined sources
Helixi1222 – 123514Combined sources
Turni1248 – 12503Combined sources
Helixi1251 – 12544Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3TU5X-ray3.00B1201-1332[»]
4JHDX-ray2.91C/F1176-1337[»]
ProteinModelPortaliQ5NBX1.
SMRiQ5NBX1. Positions 1184-1264.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1185 – 120521WH2 1PROSITE-ProRule annotationAdd
BLAST
Domaini1225 – 124521WH2 2PROSITE-ProRule annotationAdd
BLAST
Domaini1313 – 133321WH2 3PROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi323 – 3286KKRRAP 1
Motifi356 – 3616KKRRAP 2

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi22 – 254Poly-Pro
Compositional biasi361 – 43373Pro-richAdd
BLAST
Compositional biasi1277 – 129317Pro-richAdd
BLAST

Sequence similaritiesi

Contains 3 WH2 domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IJC4. Eukaryota.
ENOG410YD9K. LUCA.
GeneTreeiENSGT00530000063608.
HOVERGENiHBG081301.
InParanoidiQ5NBX1.
KOiK18623.
OMAiNELPWQI.
OrthoDBiEOG091G01LF.
PhylomeDBiQ5NBX1.
TreeFamiTF333490.

Family and domain databases

InterProiIPR019025. Cordon-bleu_ubiquitin_domain.
IPR003124. WH2_dom.
[Graphical view]
PfamiPF09469. Cobl. 1 hit.
PF02205. WH2. 3 hits.
[Graphical view]
SMARTiSM00246. WH2. 3 hits.
[Graphical view]
PROSITEiPS51082. WH2. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5NBX1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDAPRALAAK PPTGRKMKAR APPPPGKPAA QNVHSEQKLP HDATLGSQQS
60 70 80 90 100
LVYMKEALQN STLDITVVLP SGLEKQSVVS GSHAMMDLLV ELCLQNHLNP
110 120 130 140 150
SHHVLEIWSS ETQQPLSFKP NTLIGSLNVH TVLLKEKVPE ERVKPGLTKA
160 170 180 190 200
PEKSVRLVVN YLRTQKAVVR VSPEVPLQNI LPVICAKCEV NPEHVILLRD
210 220 230 240 250
NVAGEELELS KSLNELGIKE LYAWDNRREM FRKSSLGNDE TDKEKKKFLG
260 270 280 290 300
FFKANKRSNS KAEHLGLSGA DSDEDPAKSA SGGDLNGCVT TPNSPSLHSR
310 320 330 340 350
SLTLGPSLSL GNISGVSMKS DMKKRRAPPP PSPKLLGQDK VSEKASLSSQ
360 370 380 390 400
ADLQKKKRRA PAPPPPQQPP PSPVVPNRKE DKEENRKSTV GVGRQVPQKP
410 420 430 440 450
PRGTARGPPQ LVLPPPPPYP PPDTDVTEPV TFPGEGAGSE TSELRPKLSL
460 470 480 490 500
PLGPGSHCSM GGVSQVPAES EETASEDTTE DSGVMSSPSD AISLDSQQDS
510 520 530 540 550
MRSKDKWSTD QEDGSDQDLA GTPELGPQKS PSWGKSGSGS SILRTEKATM
560 570 580 590 600
PTNDDEDLFI TGHLHQTLAE LDEDLEGMEE NYETDTSSLT NSVNGVSNHS
610 620 630 640 650
LQEAIIPDSG VDDIPVTFIG EVSDEPFDSG LFSSRCNNAT TFNTGSIASQ
660 670 680 690 700
RSHLSPSQTE HSQPFVRTSR KEPDPSPPSQ DNRKRNQPTL ANTSENENPV
710 720 730 740 750
ETDPTVTSLV SKLLIDDPKA KDKGKVHGSS HSEKTQAGHG INSLRVNPRD
760 770 780 790 800
GKDESSNSAP PPWSHHGQAL GGSYGLKYGL TTYKIVPPKS EMRCYDRDVS
810 820 830 840 850
LSTGAIKIDE LGNLVSPHMN GSRTISPPSA VVETDTPPIG KVKEFWRRNS
860 870 880 890 900
MEKYLNGPAE CTIKRAPSTT ITATPEKPQQ DNGMKAAFTV TTPQQQPASQ
910 920 930 940 950
EYGAHLEEER SRPQSAVSCS VKVPASNPTD ITFLKPQRRT SSQYVASAIA
960 970 980 990 1000
KKMGPPKVHA DVVRPHKATT EQCHEEAKLA RSPPTRKDDA APNLHSEARQ
1010 1020 1030 1040 1050
HEHGTNQSSV CLPSNPGVQL PAGGHPKVEV NSTYGKSSTQ DYPAAVHRNS
1060 1070 1080 1090 1100
YFLPGRSSHR DRVSVGQSCG FNEKQTTSNQ KANSTSNFSQ ALDKAHPPPL
1110 1120 1130 1140 1150
LLAEARDSGR ILMNGSARTP GNCEPPHSPK ESTLTSYIIL QTEEKPSSLS
1160 1170 1180 1190 1200
TDGQDADDTL PSSIFGPKKK FKPVIQRPLP KDVSLHSALM EAIHSSGGRE
1210 1220 1230 1240 1250
KLRKTAEQTS EGRPKKPSYV EAESERSALL AAIRGHSGTL SLRKVSSLAS
1260 1270 1280 1290 1300
EELQSFRNAA LGAPGLDKPQ QEDLGLPPPP ALPPPPAPAP QAPSASVTVS
1310 1320 1330
RFSTGTPSNS VNARQALMDA IRSGTGAARL RKVPLLV
Length:1,337
Mass (Da):143,865
Last modified:February 1, 2005 - v1
Checksum:iF4A8D3250294A277
GO
Isoform 2 (identifier: Q5NBX1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-286: Missing.
     391-448: GVGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVTEPVTFPGEGAGSETSELRPKL → V

Show »
Length:1,255
Mass (Da):135,523
Checksum:i7FCFE31086D86DF1
GO
Isoform 3 (identifier: Q5NBX1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.

Show »
Length:1,321
Mass (Da):142,203
Checksum:iF9453527654F8494
GO
Isoform 4 (identifier: Q5NBX1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     448-469: LSLPLGPGSHCSMGGVSQVPAE → RTCLLLPFQLCVDHLSFWSLLV
     470-1337: Missing.

Show »
Length:469
Mass (Da):51,101
Checksum:i22FCBE456E0F4397
GO
Isoform 5 (identifier: Q5NBX1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     345-349: ASLSS → VPLLV
     350-1337: Missing.

Show »
Length:349
Mass (Da):38,036
Checksum:i80B82DE94D73CD2F
GO

Sequence cautioni

The sequence AAH23264 differs from that shown. Reason: Frameshift at position 1291. Curated
The sequence BAC65616 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti10 – 101K → Q in BAC33896 (PubMed:16141072).Curated
Sequence conflicti18 – 181K → R in BAC33896 (PubMed:16141072).Curated
Sequence conflicti45 – 451L → M in BAC26144 (PubMed:16141072).Curated
Sequence conflicti112 – 1121T → N in AAP74341 (PubMed:14512015).Curated
Sequence conflicti128 – 1281N → S in BAC26144 (PubMed:16141072).Curated
Sequence conflicti801 – 8011L → F in AAP74341 (PubMed:14512015).Curated
Sequence conflicti914 – 9141Q → R in BAC65616 (PubMed:19468303).Curated
Sequence conflicti1010 – 10101V → I in AAH23264 (PubMed:15489334).Curated
Sequence conflicti1112 – 11121L → V in AAH23264 (PubMed:15489334).Curated
Sequence conflicti1205 – 12051T → V in AAP74341 (PubMed:14512015).Curated
Sequence conflicti1285 – 12851P → T in AAP74341 (PubMed:14512015).Curated
Sequence conflicti1285 – 12851P → T in AAH23264 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1616Missing in isoform 3. 1 PublicationVSP_021614Add
BLAST
Alternative sequencei262 – 28625Missing in isoform 2. CuratedVSP_021615Add
BLAST
Alternative sequencei345 – 3495ASLSS → VPLLV in isoform 5. 1 PublicationVSP_021616
Alternative sequencei350 – 1337988Missing in isoform 5. 1 PublicationVSP_021617Add
BLAST
Alternative sequencei391 – 44858GVGRQ…LRPKL → V in isoform 2. CuratedVSP_021618Add
BLAST
Alternative sequencei448 – 46922LSLPL…QVPAE → RTCLLLPFQLCVDHLSFWSL LV in isoform 4. 1 PublicationVSP_021619Add
BLAST
Alternative sequencei470 – 1337868Missing in isoform 4. 1 PublicationVSP_021620Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY308745 mRNA. Translation: AAP74341.1.
AK122334 mRNA. Translation: BAC65616.1. Different initiation.
AK028833 mRNA. Translation: BAC26144.1.
AK049730 mRNA. Translation: BAC33896.1.
AL669822, AL713914 Genomic DNA. Translation: CAI35985.1.
AL669822, AL713914 Genomic DNA. Translation: CAI35986.1.
AL713914, AL669822 Genomic DNA. Translation: CAI36022.1.
AL713914, AL669822 Genomic DNA. Translation: CAI36023.1.
BC023264 mRNA. Translation: AAH23264.1. Frameshift.
BC060061 mRNA. Translation: AAH60061.1.
U26967 mRNA. Translation: AAA92362.1.
CCDSiCCDS36113.1. [Q5NBX1-1]
RefSeqiNP_766084.3. NM_172496.3. [Q5NBX1-1]
XP_006514548.1. XM_006514485.2. [Q5NBX1-2]
UniGeneiMm.22847.

Genome annotation databases

EnsembliENSMUST00000046755; ENSMUSP00000045693; ENSMUSG00000020173. [Q5NBX1-1]
ENSMUST00000109650; ENSMUSP00000105277; ENSMUSG00000020173. [Q5NBX1-2]
ENSMUST00000172919; ENSMUSP00000133669; ENSMUSG00000020173. [Q5NBX1-5]
GeneIDi12808.
KEGGimmu:12808.
UCSCiuc007ibd.2. mouse. [Q5NBX1-1]
uc007ibf.2. mouse. [Q5NBX1-4]
uc011xrq.1. mouse. [Q5NBX1-5]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY308745 mRNA. Translation: AAP74341.1.
AK122334 mRNA. Translation: BAC65616.1. Different initiation.
AK028833 mRNA. Translation: BAC26144.1.
AK049730 mRNA. Translation: BAC33896.1.
AL669822, AL713914 Genomic DNA. Translation: CAI35985.1.
AL669822, AL713914 Genomic DNA. Translation: CAI35986.1.
AL713914, AL669822 Genomic DNA. Translation: CAI36022.1.
AL713914, AL669822 Genomic DNA. Translation: CAI36023.1.
BC023264 mRNA. Translation: AAH23264.1. Frameshift.
BC060061 mRNA. Translation: AAH60061.1.
U26967 mRNA. Translation: AAA92362.1.
CCDSiCCDS36113.1. [Q5NBX1-1]
RefSeqiNP_766084.3. NM_172496.3. [Q5NBX1-1]
XP_006514548.1. XM_006514485.2. [Q5NBX1-2]
UniGeneiMm.22847.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3TU5X-ray3.00B1201-1332[»]
4JHDX-ray2.91C/F1176-1337[»]
ProteinModelPortaliQ5NBX1.
SMRiQ5NBX1. Positions 1184-1264.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-39834N.
IntActiQ5NBX1. 5 interactions.
MINTiMINT-8244298.
STRINGi10090.ENSMUSP00000045693.

PTM databases

iPTMnetiQ5NBX1.
PhosphoSiteiQ5NBX1.

Proteomic databases

MaxQBiQ5NBX1.
PaxDbiQ5NBX1.
PeptideAtlasiQ5NBX1.
PRIDEiQ5NBX1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000046755; ENSMUSP00000045693; ENSMUSG00000020173. [Q5NBX1-1]
ENSMUST00000109650; ENSMUSP00000105277; ENSMUSG00000020173. [Q5NBX1-2]
ENSMUST00000172919; ENSMUSP00000133669; ENSMUSG00000020173. [Q5NBX1-5]
GeneIDi12808.
KEGGimmu:12808.
UCSCiuc007ibd.2. mouse. [Q5NBX1-1]
uc007ibf.2. mouse. [Q5NBX1-4]
uc011xrq.1. mouse. [Q5NBX1-5]

Organism-specific databases

CTDi23242.
MGIiMGI:105056. Cobl.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IJC4. Eukaryota.
ENOG410YD9K. LUCA.
GeneTreeiENSGT00530000063608.
HOVERGENiHBG081301.
InParanoidiQ5NBX1.
KOiK18623.
OMAiNELPWQI.
OrthoDBiEOG091G01LF.
PhylomeDBiQ5NBX1.
TreeFamiTF333490.

Miscellaneous databases

PROiQ5NBX1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020173.
CleanExiMM_COBL.
ExpressionAtlasiQ5NBX1. baseline and differential.
GenevisibleiQ5NBX1. MM.

Family and domain databases

InterProiIPR019025. Cordon-bleu_ubiquitin_domain.
IPR003124. WH2_dom.
[Graphical view]
PfamiPF09469. Cobl. 1 hit.
PF02205. WH2. 3 hits.
[Graphical view]
SMARTiSM00246. WH2. 3 hits.
[Graphical view]
PROSITEiPS51082. WH2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCOBL_MOUSE
AccessioniPrimary (citable) accession number: Q5NBX1
Secondary accession number(s): Q5NBX2
, Q60859, Q6PAT4, Q7TQM9, Q80TV4, Q8C7Q0, Q8CE81, Q8CIM4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: February 1, 2005
Last modified: September 7, 2016
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.