SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5MIZ7

- P4R3B_HUMAN

UniProt

Q5MIZ7 - P4R3B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Serine/threonine-protein phosphatase 4 regulatory subunit 3B
Gene
SMEK2, KIAA1387, PP4R3B, PPP4R3B
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C at centrosomal microtubule organizing centers.

GO - Biological processi

  1. positive regulation of gluconeogenesis Source: Ensembl
  2. protein dephosphorylation Source: Ensembl
  3. regulation of lipid metabolic process Source: Ensembl
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 4 regulatory subunit 3B
Alternative name(s):
SMEK homolog 2
Gene namesi
Name:SMEK2
Synonyms:KIAA1387, PP4R3B, PPP4R3B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:29267. SMEK2.

Subcellular locationi

Cytoplasm. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Nucleus
Note: In interphase localized in the cytoplasm and (with higher levels) the nucleus. During metaphase located in pericentriolar regions.1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. microtubule organizing center Source: UniProtKB-SubCell
  3. nucleus Source: UniProtKB-SubCell
  4. protein phosphatase 4 complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162403977.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 849849Serine/threonine-protein phosphatase 4 regulatory subunit 3B
PRO_0000254603Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei117 – 1171Phosphoserine1 Publication
Modified residuei840 – 8401Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ5MIZ7.
PaxDbiQ5MIZ7.
PRIDEiQ5MIZ7.

PTM databases

PhosphoSiteiQ5MIZ7.

Expressioni

Tissue specificityi

Moderately expressed in tissues and specific brain regions examined.1 Publication

Gene expression databases

BgeeiQ5MIZ7.
CleanExiHS_SMEK2.
GenevestigatoriQ5MIZ7.

Organism-specific databases

HPAiCAB017185.
HPA001233.

Interactioni

Subunit structurei

Serine/threonine-protein phosphatase 4 (PP4) occurs in different assemblies of the catalytic and one or more regulatory subunits. Component of the PP4 complex PPP4C-PPP4R2-PPP4R3B.1 Publication

Protein-protein interaction databases

BioGridi121459. 20 interactions.
IntActiQ5MIZ7. 5 interactions.
MINTiMINT-1403551.
STRINGi9606.ENSP00000339769.

Structurei

3D structure databases

ProteinModelPortaliQ5MIZ7.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 100100WH1
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi719 – 7246Poly-Glu
Compositional biasi831 – 8388Poly-Glu

Sequence similaritiesi

Belongs to the SMEK family.
Contains 1 WH1 domain.

Phylogenomic databases

eggNOGiNOG314899.
HOVERGENiHBG056624.
InParanoidiQ5MIZ7.
KOiK17491.
OMAiGRYEQEK.
OrthoDBiEOG7ZSHS7.
PhylomeDBiQ5MIZ7.
TreeFamiTF315190.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR006887. DUF625.
IPR011993. PH_like_dom.
[Graphical view]
PfamiPF04802. SMK-1. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 2 hits.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5MIZ7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSDTRRRVKV YTLNEDRQWD DRGTGHVSST YVEELKGMSL LVRAESDGSL    50
LLESKINPNT AYQKQQDTLI VWSEAENYDL ALSFQEKAGC DEIWEKICQV 100
QGKDPSVEVT QDLIDESEEE RFEEMPETSH LIDLPTCELN KLEEIADLVT 150
SVLSSPIRRE KLALALENEG YIKKLLQLFQ ACENLENTEG LHHLYEIIRG 200
ILFLNKATLF EVMFSDECIM DVVGCLEYDP ALAQPKRHRE FLTKTAKFKE 250
VIPITDSELR QKIHQTYRVQ YIQDIILPTP SVFEENFLST LTSFIFFNKV 300
EIVSMLQEDE KFLSEVFAQL TDEATDDDKR RELVNFFKEF CAFSQTLQPQ 350
NRDAFFKTLA KLGILPALEI VMGMDDLQVR SAATDIFSYL VEFSPSMVRE 400
FVMQEAQQSD DDILLINVVI EQMICDTDPE LGGAVQLMGL LRTLIDPENM 450
LATTNKTEKS EFLNFFYNHC MHVLTAPLLT NTSEDKCEKD FFLKHYRYSW 500
SFICTPSHSH SHSTPSSSIS QDNIVGSNKN NTICPDNYQT AQLLALILEL 550
LTFCVEHHTY HIKNYIMNKD LLRRVLVLMN SKHTFLALCA LRFMRRIIGL 600
KDEFYNRYIT KGNLFEPVIN ALLDNGTRYN LLNSAVIELF EFIRVEDIKS 650
LTAHIVENFY KALESIEYVQ TFKGLKTKYE QEKDRQNQKL NSVPSILRSN 700
RFRRDAKALE EDEEMWFNED EEEEGKAVVA PVEKPKPEDD FPDNYEKFME 750
TKKAKESEDK ENLPKRTSPG GFKFTFSHSA SAANGTNSKS VVAQIPPATS 800
NGSSSKTTNL PTSVTATKGS LVGLVDYPDD EEEDEEEESS PRKRPRLGS 849
Length:849
Mass (Da):97,458
Last modified:May 31, 2011 - v2
Checksum:iCEA2C74C0F2B3D27
GO
Isoform 2 (identifier: Q5MIZ7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     491-522: Missing.

Show »
Length:817
Mass (Da):93,718
Checksum:iA0D85F04FC47C546
GO
Isoform 3 (identifier: Q5MIZ7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     491-522: Missing.
     536-589: DNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALC → G

Note: No experimental confirmation available.

Show »
Length:764
Mass (Da):87,377
Checksum:i9EE88E92C7E6D822
GO
Isoform 4 (identifier: Q5MIZ7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-55: SLLLESK → KVIGTVE
     56-849: Missing.

Note: May be due to intron retention. No experimental confirmation available.

Show »
Length:55
Mass (Da):6,272
Checksum:i834FDCC0E1CE827B
GO
Isoform 5 (identifier: Q5MIZ7-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-566: Missing.
     693-699: Missing.

Note: No experimental confirmation available.

Show »
Length:276
Mass (Da):31,566
Checksum:iD21D930BC6B8ACB5
GO

Sequence cautioni

The sequence BAA92625.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti293 – 2931S → T.
Corresponds to variant rs34999684 [ dbSNP | Ensembl ].
VAR_057734
Natural varianti503 – 5031I → V.2 Publications
Corresponds to variant rs2903704 [ dbSNP | Ensembl ].
VAR_065187

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 566566Missing in isoform 5.
VSP_021258Add
BLAST
Alternative sequencei49 – 557SLLLESK → KVIGTVE in isoform 4.
VSP_021259
Alternative sequencei56 – 849794Missing in isoform 4.
VSP_021260Add
BLAST
Alternative sequencei491 – 52232Missing in isoform 2 and isoform 3.
VSP_021261Add
BLAST
Alternative sequencei536 – 58954DNYQT…FLALC → G in isoform 3.
VSP_021262Add
BLAST
Alternative sequencei693 – 6997Missing in isoform 5.
VSP_021263

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti806 – 8061K → E in BAB14430. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY825268 mRNA. Translation: AAV97750.1.
AY825269 mRNA. Translation: AAV97751.1.
AB037808 mRNA. Translation: BAA92625.1. Different initiation.
AK023148 mRNA. Translation: BAB14430.1.
AC015982 Genomic DNA. Translation: AAY24270.1.
BC006215 mRNA. Translation: AAH06215.1.
BC045714 mRNA. Translation: AAH45714.1.
BC060855 mRNA. Translation: AAH60855.1.
AL136556 mRNA. Translation: CAB66491.2.
CCDSiCCDS1855.1. [Q5MIZ7-3]
CCDS46289.1. [Q5MIZ7-1]
CCDS62913.1. [Q5MIZ7-2]
RefSeqiNP_001116436.2. NM_001122964.2.
NP_001269779.1. NM_001282850.1. [Q5MIZ7-2]
NP_065196.1. NM_020463.3. [Q5MIZ7-3]
UniGeneiHs.516182.
Hs.654969.

Genome annotation databases

EnsembliENST00000272313; ENSP00000272313; ENSG00000138041. [Q5MIZ7-3]
ENST00000345102; ENSP00000339769; ENSG00000138041. [Q5MIZ7-1]
ENST00000407823; ENSP00000385912; ENSG00000138041. [Q5MIZ7-2]
GeneIDi57223.
KEGGihsa:57223.
UCSCiuc002ryz.3. human. [Q5MIZ7-5]
uc002rza.3. human. [Q5MIZ7-3]
uc002rzc.3. human. [Q5MIZ7-1]
uc002rzd.3. human. [Q5MIZ7-2]

Polymorphism databases

DMDMi334302843.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY825268 mRNA. Translation: AAV97750.1 .
AY825269 mRNA. Translation: AAV97751.1 .
AB037808 mRNA. Translation: BAA92625.1 . Different initiation.
AK023148 mRNA. Translation: BAB14430.1 .
AC015982 Genomic DNA. Translation: AAY24270.1 .
BC006215 mRNA. Translation: AAH06215.1 .
BC045714 mRNA. Translation: AAH45714.1 .
BC060855 mRNA. Translation: AAH60855.1 .
AL136556 mRNA. Translation: CAB66491.2 .
CCDSi CCDS1855.1. [Q5MIZ7-3 ]
CCDS46289.1. [Q5MIZ7-1 ]
CCDS62913.1. [Q5MIZ7-2 ]
RefSeqi NP_001116436.2. NM_001122964.2.
NP_001269779.1. NM_001282850.1. [Q5MIZ7-2 ]
NP_065196.1. NM_020463.3. [Q5MIZ7-3 ]
UniGenei Hs.516182.
Hs.654969.

3D structure databases

ProteinModelPortali Q5MIZ7.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121459. 20 interactions.
IntActi Q5MIZ7. 5 interactions.
MINTi MINT-1403551.
STRINGi 9606.ENSP00000339769.

PTM databases

PhosphoSitei Q5MIZ7.

Polymorphism databases

DMDMi 334302843.

Proteomic databases

MaxQBi Q5MIZ7.
PaxDbi Q5MIZ7.
PRIDEi Q5MIZ7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000272313 ; ENSP00000272313 ; ENSG00000138041 . [Q5MIZ7-3 ]
ENST00000345102 ; ENSP00000339769 ; ENSG00000138041 . [Q5MIZ7-1 ]
ENST00000407823 ; ENSP00000385912 ; ENSG00000138041 . [Q5MIZ7-2 ]
GeneIDi 57223.
KEGGi hsa:57223.
UCSCi uc002ryz.3. human. [Q5MIZ7-5 ]
uc002rza.3. human. [Q5MIZ7-3 ]
uc002rzc.3. human. [Q5MIZ7-1 ]
uc002rzd.3. human. [Q5MIZ7-2 ]

Organism-specific databases

CTDi 57223.
GeneCardsi GC02M055775.
HGNCi HGNC:29267. SMEK2.
HPAi CAB017185.
HPA001233.
MIMi 610352. gene.
neXtProti NX_Q5MIZ7.
PharmGKBi PA162403977.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG314899.
HOVERGENi HBG056624.
InParanoidi Q5MIZ7.
KOi K17491.
OMAi GRYEQEK.
OrthoDBi EOG7ZSHS7.
PhylomeDBi Q5MIZ7.
TreeFami TF315190.

Miscellaneous databases

ChiTaRSi SMEK2. human.
GeneWikii SMEK2.
GenomeRNAii 57223.
NextBioi 63355.
PROi Q5MIZ7.
SOURCEi Search...

Gene expression databases

Bgeei Q5MIZ7.
CleanExi HS_SMEK2.
Genevestigatori Q5MIZ7.

Family and domain databases

Gene3Di 2.30.29.30. 1 hit.
InterProi IPR016024. ARM-type_fold.
IPR006887. DUF625.
IPR011993. PH_like_dom.
[Graphical view ]
Pfami PF04802. SMK-1. 1 hit.
[Graphical view ]
SUPFAMi SSF48371. SSF48371. 2 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-503.
  2. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-503, TISSUE SPECIFICITY.
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
    Tissue: Brain and Placenta.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 524-849.
    Tissue: Amygdala.
  7. "A novel, evolutionarily conserved protein phosphatase complex involved in cisplatin sensitivity."
    Gingras A.-C., Caballero M., Zarske M., Sanchez A., Hazbun T.R., Fields S., Sonenberg N., Hafen E., Raught B., Aebersold R.
    Mol. Cell. Proteomics 4:1725-1740(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PPP4C AND PPP4R2, IDENTIFICATION BY MASS SPECTROMETRY.
  8. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-840, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Depletion of protein phosphatase 4 in human cells reveals essential roles in centrosome maturation, cell migration and the regulation of Rho GTPases."
    Martin-Granados C., Philp A., Oxenham S.K., Prescott A.R., Cohen P.T.W.
    Int. J. Biochem. Cell Biol. 40:2315-2332(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  10. "A PP4-phosphatase complex dephosphorylates gamma-H2AX generated during DNA replication."
    Chowdhury D., Xu X., Zhong X., Ahmed F., Zhong J., Liao J., Dykxhoorn D.M., Weinstock D.M., Pfeifer G.P., Lieberman J.
    Mol. Cell 31:33-46(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE PPP4C-PPP4R2-PPP4R3B COMPLEX.
  11. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-117, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiP4R3B_HUMAN
AccessioniPrimary (citable) accession number: Q5MIZ7
Secondary accession number(s): Q6P9B0
, Q86XB8, Q9BQJ0, Q9BRK2, Q9H913, Q9P2G0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: May 31, 2011
Last modified: July 9, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi