Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein phosphatase 4 regulatory subunit 3B

Gene

PPP4R3B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C at centrosomal microtubule organizing centers.

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 4 regulatory subunit 3B
Alternative name(s):
SMEK homolog 2
Gene namesi
Name:PPP4R3BImported
Synonyms:KIAA1387, PP4R3B, SMEK2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:29267. PPP4R3B.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi57223.
OpenTargetsiENSG00000275052.
PharmGKBiPA162403977.

Polymorphism and mutation databases

DMDMi334302843.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002546031 – 849Serine/threonine-protein phosphatase 4 regulatory subunit 3BAdd BLAST849

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei117PhosphoserineCombined sources1
Modified residuei695PhosphoserineCombined sources1
Modified residuei840PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ5MIZ7.
MaxQBiQ5MIZ7.
PaxDbiQ5MIZ7.
PeptideAtlasiQ5MIZ7.
PRIDEiQ5MIZ7.

PTM databases

iPTMnetiQ5MIZ7.
PhosphoSitePlusiQ5MIZ7.

Expressioni

Tissue specificityi

Moderately expressed in tissues and specific brain regions examined.1 Publication

Gene expression databases

BgeeiENSG00000138041.
CleanExiHS_SMEK2.
GenevisibleiQ5MIZ7. HS.

Organism-specific databases

HPAiCAB017185.
HPA001233.

Interactioni

Subunit structurei

Serine/threonine-protein phosphatase 4 (PP4) occurs in different assemblies of the catalytic and one or more regulatory subunits. Component of the PP4 complex PPP4C-PPP4R2-PPP4R3B.1 Publication

Protein-protein interaction databases

BioGridi121459. 40 interactors.
IntActiQ5MIZ7. 11 interactors.
MINTiMINT-1403551.
STRINGi9606.ENSP00000339769.

Structurei

3D structure databases

ProteinModelPortaliQ5MIZ7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 100WH1Add BLAST100

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi719 – 724Poly-Glu6
Compositional biasi831 – 838Poly-Glu8

Sequence similaritiesi

Belongs to the SMEK family.Curated
Contains 1 WH1 domain.Curated

Phylogenomic databases

eggNOGiKOG2175. Eukaryota.
ENOG410XQ7A. LUCA.
GeneTreeiENSGT00390000018199.
HOVERGENiHBG056624.
InParanoidiQ5MIZ7.
KOiK17491.
OMAiDITQDPI.
OrthoDBiEOG091G02OO.
PhylomeDBiQ5MIZ7.
TreeFamiTF315190.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR006887. DUF625.
IPR011993. PH_dom-like.
[Graphical view]
PfamiPF04802. SMK-1. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 2 hits.
SSF50729. SSF50729. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5MIZ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDTRRRVKV YTLNEDRQWD DRGTGHVSST YVEELKGMSL LVRAESDGSL
60 70 80 90 100
LLESKINPNT AYQKQQDTLI VWSEAENYDL ALSFQEKAGC DEIWEKICQV
110 120 130 140 150
QGKDPSVEVT QDLIDESEEE RFEEMPETSH LIDLPTCELN KLEEIADLVT
160 170 180 190 200
SVLSSPIRRE KLALALENEG YIKKLLQLFQ ACENLENTEG LHHLYEIIRG
210 220 230 240 250
ILFLNKATLF EVMFSDECIM DVVGCLEYDP ALAQPKRHRE FLTKTAKFKE
260 270 280 290 300
VIPITDSELR QKIHQTYRVQ YIQDIILPTP SVFEENFLST LTSFIFFNKV
310 320 330 340 350
EIVSMLQEDE KFLSEVFAQL TDEATDDDKR RELVNFFKEF CAFSQTLQPQ
360 370 380 390 400
NRDAFFKTLA KLGILPALEI VMGMDDLQVR SAATDIFSYL VEFSPSMVRE
410 420 430 440 450
FVMQEAQQSD DDILLINVVI EQMICDTDPE LGGAVQLMGL LRTLIDPENM
460 470 480 490 500
LATTNKTEKS EFLNFFYNHC MHVLTAPLLT NTSEDKCEKD FFLKHYRYSW
510 520 530 540 550
SFICTPSHSH SHSTPSSSIS QDNIVGSNKN NTICPDNYQT AQLLALILEL
560 570 580 590 600
LTFCVEHHTY HIKNYIMNKD LLRRVLVLMN SKHTFLALCA LRFMRRIIGL
610 620 630 640 650
KDEFYNRYIT KGNLFEPVIN ALLDNGTRYN LLNSAVIELF EFIRVEDIKS
660 670 680 690 700
LTAHIVENFY KALESIEYVQ TFKGLKTKYE QEKDRQNQKL NSVPSILRSN
710 720 730 740 750
RFRRDAKALE EDEEMWFNED EEEEGKAVVA PVEKPKPEDD FPDNYEKFME
760 770 780 790 800
TKKAKESEDK ENLPKRTSPG GFKFTFSHSA SAANGTNSKS VVAQIPPATS
810 820 830 840
NGSSSKTTNL PTSVTATKGS LVGLVDYPDD EEEDEEEESS PRKRPRLGS
Length:849
Mass (Da):97,458
Last modified:May 31, 2011 - v2
Checksum:iCEA2C74C0F2B3D27
GO
Isoform 2 (identifier: Q5MIZ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     491-522: Missing.

Show »
Length:817
Mass (Da):93,718
Checksum:iA0D85F04FC47C546
GO
Isoform 3 (identifier: Q5MIZ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     491-522: Missing.
     536-589: DNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALC → G

Note: No experimental confirmation available.
Show »
Length:764
Mass (Da):87,377
Checksum:i9EE88E92C7E6D822
GO
Isoform 4 (identifier: Q5MIZ7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-55: SLLLESK → KVIGTVE
     56-849: Missing.

Note: May be due to intron retention. No experimental confirmation available.
Show »
Length:55
Mass (Da):6,272
Checksum:i834FDCC0E1CE827B
GO
Isoform 5 (identifier: Q5MIZ7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-566: Missing.
     693-699: Missing.

Note: No experimental confirmation available.
Show »
Length:276
Mass (Da):31,566
Checksum:iD21D930BC6B8ACB5
GO

Sequence cautioni

The sequence BAA92625 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti806K → E in BAB14430 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057734293S → T.Corresponds to variant rs34999684dbSNPEnsembl.1
Natural variantiVAR_065187503I → V.2 PublicationsCorresponds to variant rs2903704dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0212581 – 566Missing in isoform 5. 1 PublicationAdd BLAST566
Alternative sequenceiVSP_02125949 – 55SLLLESK → KVIGTVE in isoform 4. 1 Publication7
Alternative sequenceiVSP_02126056 – 849Missing in isoform 4. 1 PublicationAdd BLAST794
Alternative sequenceiVSP_021261491 – 522Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_021262536 – 589DNYQT…FLALC → G in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_021263693 – 699Missing in isoform 5. 1 Publication7

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY825268 mRNA. Translation: AAV97750.1.
AY825269 mRNA. Translation: AAV97751.1.
AB037808 mRNA. Translation: BAA92625.1. Different initiation.
AK023148 mRNA. Translation: BAB14430.1.
AC015982 Genomic DNA. Translation: AAY24270.1.
BC006215 mRNA. Translation: AAH06215.1.
BC045714 mRNA. Translation: AAH45714.1.
BC060855 mRNA. Translation: AAH60855.1.
AL136556 mRNA. Translation: CAB66491.2.
CCDSiCCDS1855.1. [Q5MIZ7-3]
CCDS46289.1. [Q5MIZ7-1]
CCDS62913.1. [Q5MIZ7-2]
RefSeqiNP_001116436.2. NM_001122964.2.
NP_001269779.1. NM_001282850.1. [Q5MIZ7-2]
NP_065196.1. NM_020463.3. [Q5MIZ7-3]
UniGeneiHs.516182.
Hs.654969.

Genome annotation databases

EnsembliENST00000611717; ENSP00000478677; ENSG00000275052. [Q5MIZ7-3]
ENST00000616288; ENSP00000484116; ENSG00000275052. [Q5MIZ7-2]
ENST00000616407; ENSP00000483228; ENSG00000275052. [Q5MIZ7-1]
GeneIDi57223.
KEGGihsa:57223.
UCSCiuc032nnw.2. human. [Q5MIZ7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY825268 mRNA. Translation: AAV97750.1.
AY825269 mRNA. Translation: AAV97751.1.
AB037808 mRNA. Translation: BAA92625.1. Different initiation.
AK023148 mRNA. Translation: BAB14430.1.
AC015982 Genomic DNA. Translation: AAY24270.1.
BC006215 mRNA. Translation: AAH06215.1.
BC045714 mRNA. Translation: AAH45714.1.
BC060855 mRNA. Translation: AAH60855.1.
AL136556 mRNA. Translation: CAB66491.2.
CCDSiCCDS1855.1. [Q5MIZ7-3]
CCDS46289.1. [Q5MIZ7-1]
CCDS62913.1. [Q5MIZ7-2]
RefSeqiNP_001116436.2. NM_001122964.2.
NP_001269779.1. NM_001282850.1. [Q5MIZ7-2]
NP_065196.1. NM_020463.3. [Q5MIZ7-3]
UniGeneiHs.516182.
Hs.654969.

3D structure databases

ProteinModelPortaliQ5MIZ7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121459. 40 interactors.
IntActiQ5MIZ7. 11 interactors.
MINTiMINT-1403551.
STRINGi9606.ENSP00000339769.

PTM databases

iPTMnetiQ5MIZ7.
PhosphoSitePlusiQ5MIZ7.

Polymorphism and mutation databases

DMDMi334302843.

Proteomic databases

EPDiQ5MIZ7.
MaxQBiQ5MIZ7.
PaxDbiQ5MIZ7.
PeptideAtlasiQ5MIZ7.
PRIDEiQ5MIZ7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000611717; ENSP00000478677; ENSG00000275052. [Q5MIZ7-3]
ENST00000616288; ENSP00000484116; ENSG00000275052. [Q5MIZ7-2]
ENST00000616407; ENSP00000483228; ENSG00000275052. [Q5MIZ7-1]
GeneIDi57223.
KEGGihsa:57223.
UCSCiuc032nnw.2. human. [Q5MIZ7-1]

Organism-specific databases

CTDi57223.
DisGeNETi57223.
GeneCardsiSMEK2.
HGNCiHGNC:29267. PPP4R3B.
HPAiCAB017185.
HPA001233.
MIMi610352. gene.
neXtProtiNX_Q5MIZ7.
OpenTargetsiENSG00000275052.
PharmGKBiPA162403977.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2175. Eukaryota.
ENOG410XQ7A. LUCA.
GeneTreeiENSGT00390000018199.
HOVERGENiHBG056624.
InParanoidiQ5MIZ7.
KOiK17491.
OMAiDITQDPI.
OrthoDBiEOG091G02OO.
PhylomeDBiQ5MIZ7.
TreeFamiTF315190.

Miscellaneous databases

ChiTaRSiSMEK2. human.
GeneWikiiSMEK2.
GenomeRNAii57223.
PROiQ5MIZ7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000138041.
CleanExiHS_SMEK2.
GenevisibleiQ5MIZ7. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR006887. DUF625.
IPR011993. PH_dom-like.
[Graphical view]
PfamiPF04802. SMK-1. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 2 hits.
SSF50729. SSF50729. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiP4R3B_HUMAN
AccessioniPrimary (citable) accession number: Q5MIZ7
Secondary accession number(s): Q6P9B0
, Q86XB8, Q9BQJ0, Q9BRK2, Q9H913, Q9P2G0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: May 31, 2011
Last modified: November 30, 2016
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.