Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5MIZ7 (P4R3B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 82. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Serine/threonine-protein phosphatase 4 regulatory subunit 3B
Alternative name(s):
SMEK homolog 2
Gene names
Name:SMEK2
Synonyms:KIAA1387, PP4R3B, PPP4R3B
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length849 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C at centrosomal microtubule organizing centers.

Subunit structure

Serine/threonine-protein phosphatase 4 (PP4) occurs in different assemblies of the catalytic and one or more regulatory subunits. Component of the PP4 complex PPP4C-PPP4R2-PPP4R3B. Ref.10

Subcellular location

Cytoplasm. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Nucleus. Note: In interphase localized in the cytoplasm and (with higher levels) the nucleus. During metaphase located in pericentriolar regions. Ref.9

Tissue specificity

Moderately expressed in tissues and specific brain regions examined. Ref.2

Sequence similarities

Belongs to the SMEK family.

Contains 1 WH1 domain.

Sequence caution

The sequence BAA92625.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5MIZ7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5MIZ7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     491-522: Missing.
Isoform 3 (identifier: Q5MIZ7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     491-522: Missing.
     536-589: DNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALC → G
Note: No experimental confirmation available.
Isoform 4 (identifier: Q5MIZ7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     49-55: SLLLESK → KVIGTVE
     56-849: Missing.
Note: May be due to intron retention. No experimental confirmation available.
Isoform 5 (identifier: Q5MIZ7-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-566: Missing.
     693-699: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 849849Serine/threonine-protein phosphatase 4 regulatory subunit 3B
PRO_0000254603

Regions

Domain1 – 100100WH1
Compositional bias719 – 7246Poly-Glu
Compositional bias831 – 8388Poly-Glu

Amino acid modifications

Modified residue1171Phosphoserine Ref.13
Modified residue8401Phosphoserine Ref.8

Natural variations

Alternative sequence1 – 566566Missing in isoform 5.
VSP_021258
Alternative sequence49 – 557SLLLESK → KVIGTVE in isoform 4.
VSP_021259
Alternative sequence56 – 849794Missing in isoform 4.
VSP_021260
Alternative sequence491 – 52232Missing in isoform 2 and isoform 3.
VSP_021261
Alternative sequence536 – 58954DNYQT…FLALC → G in isoform 3.
VSP_021262
Alternative sequence693 – 6997Missing in isoform 5.
VSP_021263
Natural variant2931S → T.
Corresponds to variant rs34999684 [ dbSNP | Ensembl ].
VAR_057734
Natural variant5031I → V. Ref.1 Ref.2
Corresponds to variant rs2903704 [ dbSNP | Ensembl ].
VAR_065187

Experimental info

Sequence conflict8061K → E in BAB14430. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 31, 2011. Version 2.
Checksum: CEA2C74C0F2B3D27

FASTA84997,458
        10         20         30         40         50         60 
MSDTRRRVKV YTLNEDRQWD DRGTGHVSST YVEELKGMSL LVRAESDGSL LLESKINPNT 

        70         80         90        100        110        120 
AYQKQQDTLI VWSEAENYDL ALSFQEKAGC DEIWEKICQV QGKDPSVEVT QDLIDESEEE 

       130        140        150        160        170        180 
RFEEMPETSH LIDLPTCELN KLEEIADLVT SVLSSPIRRE KLALALENEG YIKKLLQLFQ 

       190        200        210        220        230        240 
ACENLENTEG LHHLYEIIRG ILFLNKATLF EVMFSDECIM DVVGCLEYDP ALAQPKRHRE 

       250        260        270        280        290        300 
FLTKTAKFKE VIPITDSELR QKIHQTYRVQ YIQDIILPTP SVFEENFLST LTSFIFFNKV 

       310        320        330        340        350        360 
EIVSMLQEDE KFLSEVFAQL TDEATDDDKR RELVNFFKEF CAFSQTLQPQ NRDAFFKTLA 

       370        380        390        400        410        420 
KLGILPALEI VMGMDDLQVR SAATDIFSYL VEFSPSMVRE FVMQEAQQSD DDILLINVVI 

       430        440        450        460        470        480 
EQMICDTDPE LGGAVQLMGL LRTLIDPENM LATTNKTEKS EFLNFFYNHC MHVLTAPLLT 

       490        500        510        520        530        540 
NTSEDKCEKD FFLKHYRYSW SFICTPSHSH SHSTPSSSIS QDNIVGSNKN NTICPDNYQT 

       550        560        570        580        590        600 
AQLLALILEL LTFCVEHHTY HIKNYIMNKD LLRRVLVLMN SKHTFLALCA LRFMRRIIGL 

       610        620        630        640        650        660 
KDEFYNRYIT KGNLFEPVIN ALLDNGTRYN LLNSAVIELF EFIRVEDIKS LTAHIVENFY 

       670        680        690        700        710        720 
KALESIEYVQ TFKGLKTKYE QEKDRQNQKL NSVPSILRSN RFRRDAKALE EDEEMWFNED 

       730        740        750        760        770        780 
EEEEGKAVVA PVEKPKPEDD FPDNYEKFME TKKAKESEDK ENLPKRTSPG GFKFTFSHSA 

       790        800        810        820        830        840 
SAANGTNSKS VVAQIPPATS NGSSSKTTNL PTSVTATKGS LVGLVDYPDD EEEDEEEESS 


PRKRPRLGS 

« Hide

Isoform 2 [UniParc].

Checksum: A0D85F04FC47C546
Show »

FASTA81793,718
Isoform 3 [UniParc].

Checksum: 9EE88E92C7E6D822
Show »

FASTA76487,377
Isoform 4 [UniParc].

Checksum: 834FDCC0E1CE827B
Show »

FASTA556,272
Isoform 5 [UniParc].

Checksum: D21D930BC6B8ACB5
Show »

FASTA27631,566

References

« Hide 'large scale' references
[1]"An endoribonuclease-prepared siRNA screen in human cells identifies genes essential for cell division."
Kittler R., Putz G., Pelletier L., Poser I., Heninger A.-K., Drechsel D., Fischer S., Konstantinova I., Habermann B., Grabner H., Yaspo M.-L., Himmelbauer H., Korn B., Neugebauer K., Pisabarro M.T., Buchholz F.
Nature 432:1036-1040(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-503.
[2]"Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-503, TISSUE SPECIFICITY.
Tissue: Brain.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
[4]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
Tissue: Brain and Placenta.
[6]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 524-849.
Tissue: Amygdala.
[7]"A novel, evolutionarily conserved protein phosphatase complex involved in cisplatin sensitivity."
Gingras A.-C., Caballero M., Zarske M., Sanchez A., Hazbun T.R., Fields S., Sonenberg N., Hafen E., Raught B., Aebersold R.
Mol. Cell. Proteomics 4:1725-1740(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH PPP4C AND PPP4R2, IDENTIFICATION BY MASS SPECTROMETRY.
[8]"A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-840, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"Depletion of protein phosphatase 4 in human cells reveals essential roles in centrosome maturation, cell migration and the regulation of Rho GTPases."
Martin-Granados C., Philp A., Oxenham S.K., Prescott A.R., Cohen P.T.W.
Int. J. Biochem. Cell Biol. 40:2315-2332(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
[10]"A PP4-phosphatase complex dephosphorylates gamma-H2AX generated during DNA replication."
Chowdhury D., Xu X., Zhong X., Ahmed F., Zhong J., Liao J., Dykxhoorn D.M., Weinstock D.M., Pfeifer G.P., Lieberman J.
Mol. Cell 31:33-46(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION IN THE PPP4C-PPP4R2-PPP4R3B COMPLEX.
[11]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[12]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[13]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-117, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY825268 mRNA. Translation: AAV97750.1.
AY825269 mRNA. Translation: AAV97751.1.
AB037808 mRNA. Translation: BAA92625.1. Different initiation.
AK023148 mRNA. Translation: BAB14430.1.
AC015982 Genomic DNA. Translation: AAY24270.1.
BC006215 mRNA. Translation: AAH06215.1.
BC045714 mRNA. Translation: AAH45714.1.
BC060855 mRNA. Translation: AAH60855.1.
AL136556 mRNA. Translation: CAB66491.2.
CCDSCCDS1855.1. [Q5MIZ7-3]
CCDS46289.1. [Q5MIZ7-1]
CCDS62913.1. [Q5MIZ7-2]
RefSeqNP_001116436.2. NM_001122964.2.
NP_001269779.1. NM_001282850.1. [Q5MIZ7-2]
NP_065196.1. NM_020463.3. [Q5MIZ7-3]
UniGeneHs.516182.
Hs.654969.

3D structure databases

ProteinModelPortalQ5MIZ7.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121459. 20 interactions.
IntActQ5MIZ7. 5 interactions.
MINTMINT-1403551.
STRING9606.ENSP00000339769.

PTM databases

PhosphoSiteQ5MIZ7.

Polymorphism databases

DMDM334302843.

Proteomic databases

MaxQBQ5MIZ7.
PaxDbQ5MIZ7.
PRIDEQ5MIZ7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000272313; ENSP00000272313; ENSG00000138041. [Q5MIZ7-3]
ENST00000345102; ENSP00000339769; ENSG00000138041. [Q5MIZ7-1]
ENST00000407823; ENSP00000385912; ENSG00000138041. [Q5MIZ7-2]
GeneID57223.
KEGGhsa:57223.
UCSCuc002ryz.3. human. [Q5MIZ7-5]
uc002rza.3. human. [Q5MIZ7-3]
uc002rzc.3. human. [Q5MIZ7-1]
uc002rzd.3. human. [Q5MIZ7-2]

Organism-specific databases

CTD57223.
GeneCardsGC02M055775.
HGNCHGNC:29267. SMEK2.
HPACAB017185.
HPA001233.
MIM610352. gene.
neXtProtNX_Q5MIZ7.
PharmGKBPA162403977.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG314899.
HOVERGENHBG056624.
InParanoidQ5MIZ7.
KOK17491.
OMAGRYEQEK.
OrthoDBEOG7ZSHS7.
PhylomeDBQ5MIZ7.
TreeFamTF315190.

Gene expression databases

BgeeQ5MIZ7.
CleanExHS_SMEK2.
GenevestigatorQ5MIZ7.

Family and domain databases

Gene3D2.30.29.30. 1 hit.
InterProIPR016024. ARM-type_fold.
IPR006887. DUF625.
IPR011993. PH_like_dom.
[Graphical view]
PfamPF04802. SMK-1. 1 hit.
[Graphical view]
SUPFAMSSF48371. SSF48371. 2 hits.
ProtoNetSearch...

Other

ChiTaRSSMEK2. human.
GeneWikiSMEK2.
GenomeRNAi57223.
NextBio63355.
PROQ5MIZ7.
SOURCESearch...

Entry information

Entry nameP4R3B_HUMAN
AccessionPrimary (citable) accession number: Q5MIZ7
Secondary accession number(s): Q6P9B0 expand/collapse secondary AC list , Q86XB8, Q9BQJ0, Q9BRK2, Q9H913, Q9P2G0
Entry history
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: May 31, 2011
Last modified: July 9, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM