Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5MIZ7

- P4R3B_HUMAN

UniProt

Q5MIZ7 - P4R3B_HUMAN

Protein

Serine/threonine-protein phosphatase 4 regulatory subunit 3B

Gene

SMEK2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 83 (01 Oct 2014)
      Sequence version 2 (31 May 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C at centrosomal microtubule organizing centers.

    GO - Biological processi

    1. positive regulation of gluconeogenesis Source: Ensembl
    2. protein dephosphorylation Source: Ensembl
    3. regulation of lipid metabolic process Source: Ensembl

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Serine/threonine-protein phosphatase 4 regulatory subunit 3B
    Alternative name(s):
    SMEK homolog 2
    Gene namesi
    Name:SMEK2
    Synonyms:KIAA1387, PP4R3B, PPP4R3B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:29267. SMEK2.

    Subcellular locationi

    Cytoplasm 1 Publication. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome 1 Publication. Nucleus 1 Publication
    Note: In interphase localized in the cytoplasm and (with higher levels) the nucleus. During metaphase located in pericentriolar regions.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. microtubule organizing center Source: UniProtKB-SubCell
    3. nucleus Source: UniProtKB-SubCell
    4. protein phosphatase 4 complex Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162403977.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 849849Serine/threonine-protein phosphatase 4 regulatory subunit 3BPRO_0000254603Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei117 – 1171Phosphoserine1 Publication
    Modified residuei840 – 8401Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ5MIZ7.
    PaxDbiQ5MIZ7.
    PRIDEiQ5MIZ7.

    PTM databases

    PhosphoSiteiQ5MIZ7.

    Expressioni

    Tissue specificityi

    Moderately expressed in tissues and specific brain regions examined.1 Publication

    Gene expression databases

    BgeeiQ5MIZ7.
    CleanExiHS_SMEK2.
    GenevestigatoriQ5MIZ7.

    Organism-specific databases

    HPAiCAB017185.
    HPA001233.

    Interactioni

    Subunit structurei

    Serine/threonine-protein phosphatase 4 (PP4) occurs in different assemblies of the catalytic and one or more regulatory subunits. Component of the PP4 complex PPP4C-PPP4R2-PPP4R3B.1 Publication

    Protein-protein interaction databases

    BioGridi121459. 20 interactions.
    IntActiQ5MIZ7. 5 interactions.
    MINTiMINT-1403551.
    STRINGi9606.ENSP00000339769.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5MIZ7.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 100100WH1Add
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi719 – 7246Poly-Glu
    Compositional biasi831 – 8388Poly-Glu

    Sequence similaritiesi

    Belongs to the SMEK family.Curated
    Contains 1 WH1 domain.Curated

    Phylogenomic databases

    eggNOGiNOG314899.
    HOVERGENiHBG056624.
    InParanoidiQ5MIZ7.
    KOiK17491.
    OMAiGRYEQEK.
    OrthoDBiEOG7ZSHS7.
    PhylomeDBiQ5MIZ7.
    TreeFamiTF315190.

    Family and domain databases

    Gene3Di2.30.29.30. 1 hit.
    InterProiIPR016024. ARM-type_fold.
    IPR006887. DUF625.
    IPR011993. PH_like_dom.
    [Graphical view]
    PfamiPF04802. SMK-1. 1 hit.
    [Graphical view]
    SUPFAMiSSF48371. SSF48371. 2 hits.

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5MIZ7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSDTRRRVKV YTLNEDRQWD DRGTGHVSST YVEELKGMSL LVRAESDGSL    50
    LLESKINPNT AYQKQQDTLI VWSEAENYDL ALSFQEKAGC DEIWEKICQV 100
    QGKDPSVEVT QDLIDESEEE RFEEMPETSH LIDLPTCELN KLEEIADLVT 150
    SVLSSPIRRE KLALALENEG YIKKLLQLFQ ACENLENTEG LHHLYEIIRG 200
    ILFLNKATLF EVMFSDECIM DVVGCLEYDP ALAQPKRHRE FLTKTAKFKE 250
    VIPITDSELR QKIHQTYRVQ YIQDIILPTP SVFEENFLST LTSFIFFNKV 300
    EIVSMLQEDE KFLSEVFAQL TDEATDDDKR RELVNFFKEF CAFSQTLQPQ 350
    NRDAFFKTLA KLGILPALEI VMGMDDLQVR SAATDIFSYL VEFSPSMVRE 400
    FVMQEAQQSD DDILLINVVI EQMICDTDPE LGGAVQLMGL LRTLIDPENM 450
    LATTNKTEKS EFLNFFYNHC MHVLTAPLLT NTSEDKCEKD FFLKHYRYSW 500
    SFICTPSHSH SHSTPSSSIS QDNIVGSNKN NTICPDNYQT AQLLALILEL 550
    LTFCVEHHTY HIKNYIMNKD LLRRVLVLMN SKHTFLALCA LRFMRRIIGL 600
    KDEFYNRYIT KGNLFEPVIN ALLDNGTRYN LLNSAVIELF EFIRVEDIKS 650
    LTAHIVENFY KALESIEYVQ TFKGLKTKYE QEKDRQNQKL NSVPSILRSN 700
    RFRRDAKALE EDEEMWFNED EEEEGKAVVA PVEKPKPEDD FPDNYEKFME 750
    TKKAKESEDK ENLPKRTSPG GFKFTFSHSA SAANGTNSKS VVAQIPPATS 800
    NGSSSKTTNL PTSVTATKGS LVGLVDYPDD EEEDEEEESS PRKRPRLGS 849
    Length:849
    Mass (Da):97,458
    Last modified:May 31, 2011 - v2
    Checksum:iCEA2C74C0F2B3D27
    GO
    Isoform 2 (identifier: Q5MIZ7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         491-522: Missing.

    Show »
    Length:817
    Mass (Da):93,718
    Checksum:iA0D85F04FC47C546
    GO
    Isoform 3 (identifier: Q5MIZ7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         491-522: Missing.
         536-589: DNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALC → G

    Note: No experimental confirmation available.

    Show »
    Length:764
    Mass (Da):87,377
    Checksum:i9EE88E92C7E6D822
    GO
    Isoform 4 (identifier: Q5MIZ7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         49-55: SLLLESK → KVIGTVE
         56-849: Missing.

    Note: May be due to intron retention. No experimental confirmation available.

    Show »
    Length:55
    Mass (Da):6,272
    Checksum:i834FDCC0E1CE827B
    GO
    Isoform 5 (identifier: Q5MIZ7-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-566: Missing.
         693-699: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:276
    Mass (Da):31,566
    Checksum:iD21D930BC6B8ACB5
    GO

    Sequence cautioni

    The sequence BAA92625.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti806 – 8061K → E in BAB14430. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti293 – 2931S → T.
    Corresponds to variant rs34999684 [ dbSNP | Ensembl ].
    VAR_057734
    Natural varianti503 – 5031I → V.2 Publications
    Corresponds to variant rs2903704 [ dbSNP | Ensembl ].
    VAR_065187

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 566566Missing in isoform 5. 1 PublicationVSP_021258Add
    BLAST
    Alternative sequencei49 – 557SLLLESK → KVIGTVE in isoform 4. 1 PublicationVSP_021259
    Alternative sequencei56 – 849794Missing in isoform 4. 1 PublicationVSP_021260Add
    BLAST
    Alternative sequencei491 – 52232Missing in isoform 2 and isoform 3. 2 PublicationsVSP_021261Add
    BLAST
    Alternative sequencei536 – 58954DNYQT…FLALC → G in isoform 3. 1 PublicationVSP_021262Add
    BLAST
    Alternative sequencei693 – 6997Missing in isoform 5. 1 PublicationVSP_021263

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY825268 mRNA. Translation: AAV97750.1.
    AY825269 mRNA. Translation: AAV97751.1.
    AB037808 mRNA. Translation: BAA92625.1. Different initiation.
    AK023148 mRNA. Translation: BAB14430.1.
    AC015982 Genomic DNA. Translation: AAY24270.1.
    BC006215 mRNA. Translation: AAH06215.1.
    BC045714 mRNA. Translation: AAH45714.1.
    BC060855 mRNA. Translation: AAH60855.1.
    AL136556 mRNA. Translation: CAB66491.2.
    CCDSiCCDS1855.1. [Q5MIZ7-3]
    CCDS46289.1. [Q5MIZ7-1]
    CCDS62913.1. [Q5MIZ7-2]
    RefSeqiNP_001116436.2. NM_001122964.2.
    NP_001269779.1. NM_001282850.1. [Q5MIZ7-2]
    NP_065196.1. NM_020463.3. [Q5MIZ7-3]
    UniGeneiHs.516182.
    Hs.654969.

    Genome annotation databases

    GeneIDi57223.
    KEGGihsa:57223.
    UCSCiuc002ryz.3. human. [Q5MIZ7-5]
    uc002rza.3. human. [Q5MIZ7-3]
    uc002rzc.3. human. [Q5MIZ7-1]
    uc002rzd.3. human. [Q5MIZ7-2]

    Polymorphism databases

    DMDMi334302843.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY825268 mRNA. Translation: AAV97750.1 .
    AY825269 mRNA. Translation: AAV97751.1 .
    AB037808 mRNA. Translation: BAA92625.1 . Different initiation.
    AK023148 mRNA. Translation: BAB14430.1 .
    AC015982 Genomic DNA. Translation: AAY24270.1 .
    BC006215 mRNA. Translation: AAH06215.1 .
    BC045714 mRNA. Translation: AAH45714.1 .
    BC060855 mRNA. Translation: AAH60855.1 .
    AL136556 mRNA. Translation: CAB66491.2 .
    CCDSi CCDS1855.1. [Q5MIZ7-3 ]
    CCDS46289.1. [Q5MIZ7-1 ]
    CCDS62913.1. [Q5MIZ7-2 ]
    RefSeqi NP_001116436.2. NM_001122964.2.
    NP_001269779.1. NM_001282850.1. [Q5MIZ7-2 ]
    NP_065196.1. NM_020463.3. [Q5MIZ7-3 ]
    UniGenei Hs.516182.
    Hs.654969.

    3D structure databases

    ProteinModelPortali Q5MIZ7.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121459. 20 interactions.
    IntActi Q5MIZ7. 5 interactions.
    MINTi MINT-1403551.
    STRINGi 9606.ENSP00000339769.

    PTM databases

    PhosphoSitei Q5MIZ7.

    Polymorphism databases

    DMDMi 334302843.

    Proteomic databases

    MaxQBi Q5MIZ7.
    PaxDbi Q5MIZ7.
    PRIDEi Q5MIZ7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 57223.
    KEGGi hsa:57223.
    UCSCi uc002ryz.3. human. [Q5MIZ7-5 ]
    uc002rza.3. human. [Q5MIZ7-3 ]
    uc002rzc.3. human. [Q5MIZ7-1 ]
    uc002rzd.3. human. [Q5MIZ7-2 ]

    Organism-specific databases

    CTDi 57223.
    GeneCardsi GC02M055775.
    HGNCi HGNC:29267. SMEK2.
    HPAi CAB017185.
    HPA001233.
    MIMi 610352. gene.
    neXtProti NX_Q5MIZ7.
    PharmGKBi PA162403977.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG314899.
    HOVERGENi HBG056624.
    InParanoidi Q5MIZ7.
    KOi K17491.
    OMAi GRYEQEK.
    OrthoDBi EOG7ZSHS7.
    PhylomeDBi Q5MIZ7.
    TreeFami TF315190.

    Miscellaneous databases

    ChiTaRSi SMEK2. human.
    GeneWikii SMEK2.
    GenomeRNAii 57223.
    NextBioi 63355.
    PROi Q5MIZ7.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q5MIZ7.
    CleanExi HS_SMEK2.
    Genevestigatori Q5MIZ7.

    Family and domain databases

    Gene3Di 2.30.29.30. 1 hit.
    InterProi IPR016024. ARM-type_fold.
    IPR006887. DUF625.
    IPR011993. PH_like_dom.
    [Graphical view ]
    Pfami PF04802. SMK-1. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48371. SSF48371. 2 hits.
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-503.
    2. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-503, TISSUE SPECIFICITY.
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
      Tissue: Brain and Placenta.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 524-849.
      Tissue: Amygdala.
    7. "A novel, evolutionarily conserved protein phosphatase complex involved in cisplatin sensitivity."
      Gingras A.-C., Caballero M., Zarske M., Sanchez A., Hazbun T.R., Fields S., Sonenberg N., Hafen E., Raught B., Aebersold R.
      Mol. Cell. Proteomics 4:1725-1740(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH PPP4C AND PPP4R2, IDENTIFICATION BY MASS SPECTROMETRY.
    8. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
      Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
      Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-840, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Depletion of protein phosphatase 4 in human cells reveals essential roles in centrosome maturation, cell migration and the regulation of Rho GTPases."
      Martin-Granados C., Philp A., Oxenham S.K., Prescott A.R., Cohen P.T.W.
      Int. J. Biochem. Cell Biol. 40:2315-2332(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    10. "A PP4-phosphatase complex dephosphorylates gamma-H2AX generated during DNA replication."
      Chowdhury D., Xu X., Zhong X., Ahmed F., Zhong J., Liao J., Dykxhoorn D.M., Weinstock D.M., Pfeifer G.P., Lieberman J.
      Mol. Cell 31:33-46(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN THE PPP4C-PPP4R2-PPP4R3B COMPLEX.
    11. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-117, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiP4R3B_HUMAN
    AccessioniPrimary (citable) accession number: Q5MIZ7
    Secondary accession number(s): Q6P9B0
    , Q86XB8, Q9BQJ0, Q9BRK2, Q9H913, Q9P2G0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 31, 2006
    Last sequence update: May 31, 2011
    Last modified: October 1, 2014
    This is version 83 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3