Q5MFV5 (P2C34_ORYSI) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 45.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable protein phosphatase 2C 34 Short name=OsPP2C34 EC=3.1.3.16 Alternative name(s): BTH-induced protein phosphatase 2C 2 Short name=OsBIPP2C2 | ||||
| Gene names |
| ||||
| Organism | Oryza sativa subsp. indica (Rice) | ||||
| Taxonomic identifier | 39946 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › Liliopsida › Poales › Poaceae › BEP clade › Ehrhartoideae › Oryzeae › Oryza › ![]() |
Protein attributes
| Sequence length | 380 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. |
| Cofactor | Binds 2 magnesium or manganese ions per subunit By similarity. |
| Induction | By benzothiadiazole (BTH). Ref.1 |
| Sequence similarities | Belongs to the PP2C family. Contains 1 PP2C-like domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Magnesium Manganese Metal-binding |
| Molecular function | Hydrolase Protein phosphatase |
| Gene Ontology (GO) | |
| Biological_process | protein dephosphorylation Inferred from electronic annotation. Source: InterPro |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW protein serine/threonine phosphatase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5MFV5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5MFV5-2) The sequence of this isoform differs from the canonical sequence as follows: 288-317: TGIANRLVKAALKEATRKREVSFRDLKTIE → TVSSDNIYSIRSFHHREYIFPVNERGVLTQ 318-380: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q5MFV5-3) The sequence of this isoform differs from the canonical sequence as follows: 233-255: VGPPIPLKRPALSAEPSIQVRKL → MVSGSISVTTLRCRLSSRIQGRV 256-380: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 380 | 380 | Probable protein phosphatase 2C 34 | PRO_0000363280 | |||||
Regions | |||||||||
| Domain | 26 – 307 | 282 | PP2C-like | ||||||
Sites | |||||||||
| Metal binding | 66 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 66 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 67 | 1 | Manganese 1; via carbonyl oxygen By similarity | ||||||
| Metal binding | 267 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 326 | 1 | Manganese 2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 233 – 255 | 23 | VGPPI…QVRKL → MVSGSISVTTLRCRLSSRIQ GRV in isoform 3. | VSP_036259 | |||||
| Alternative sequence | 256 – 380 | 125 | Missing in isoform 3. | VSP_036260 | |||||
| Alternative sequence | 288 – 317 | 30 | TGIAN…LKTIE → TVSSDNIYSIRSFHHREYIF PVNERGVLTQ in isoform 2. | VSP_036261 | |||||
| Alternative sequence | 318 – 380 | 63 | Missing in isoform 2. | VSP_036262 | |||||
Experimental info | |||||||||
| Sequence conflict | 84 | 1 | H → L in AAW29521. Ref.1 | ||||||
| Sequence conflict | 84 | 1 | H → L in AAW29522. Ref.1 | ||||||
| Sequence conflict | 175 | 1 | A → T in AAW29521. Ref.1 | ||||||
| Sequence conflict | 175 | 1 | A → T in AAW29522. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular characterization of four rice genes encoding ethylene-responsive transcriptional factors and their expressions in response to biotic and abiotic stress." Cao Y., Song F., Goodman R.M., Zheng Z. J. Plant Physiol. 163:1167-1178(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), INDUCTION. Strain: cv. Yuanfengzao. Tissue: Seedling. |
| [2] | "The genomes of Oryza sativa: a history of duplications." Yu J., Wang J., Lin W., Li S., Li H., Zhou J., Ni P., Dong W., Hu S., Zeng C., Zhang J., Zhang Y., Li R., Xu Z., Li S., Li X., Zheng H., Cong L. Yang H.PLoS Biol. 3:266-281(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. 93-11. |
| [3] | "Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis." Xue T., Wang D., Zhang S., Ehlting J., Ni F., Jacab S., Zheng C., Zhong Y. BMC Genomics 9:550-550(2008) [PubMed] [Europe PMC] [Abstract] Cited for: GENE FAMILY, NOMENCLATURE. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY831390 mRNA. Translation: AAW29521.1. AY831391 mRNA. Translation: AAW29522.1. CM000128 Genomic DNA. No translation available. |
3D structure databases | |
| ProteinModelPortal | Q5MFV5. |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Organism-specific databases | |
| Gramene | Q5MFV5. |
Phylogenomic databases | |
| eggNOG | COG0631. |
| HOGENOM | HOG000238703. |
Gene expression databases | |
| ArrayExpress | Q5MFV5. |
Family and domain databases | |
| Gene3D | 3.60.40.10. 1 hit. |
| InterPro | IPR001932. PP2C-like. IPR000222. PP2C_Mn2_Asp60_BS. IPR015655. Protein_Pase_2C. [Graphical view] |
| PANTHER | PTHR13832. PTHR13832. 1 hit. |
| Pfam | PF00481. PP2C. 1 hit. [Graphical view] |
| SMART | SM00331. PP2C_SIG. 1 hit. SM00332. PP2Cc. 1 hit. [Graphical view] |
| SUPFAM | SSF81606. PP2C-related. 1 hit. |
| PROSITE | PS01032. PP2C. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | P2C34_ORYSI | ||||||||
| Accession | Primary (citable) accession number: Q5MFV5 Secondary accession number(s): A2XM81, Q5MFV4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
