Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5MFV5 (P2C34_ORYSI) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 50. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Probable protein phosphatase 2C 34

Short name=OsPP2C34
EC=3.1.3.16
Alternative name(s):
BTH-induced protein phosphatase 2C 2
Short name=OsBIPP2C2
Gene names
Name:BIPP2C2
ORF Names:OsI_013174
OrganismOryza sativa subsp. indica (Rice)
Taxonomic identifier39946 [NCBI]
Taxonomic lineageEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaLiliopsidaPoalesPoaceaeBEP cladeEhrhartoideaeOryzeaeOryza

Protein attributes

Sequence length380 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Catalytic activity

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactor

Binds 2 magnesium or manganese ions per subunit By similarity.

Induction

By benzothiadiazole (BTH). Ref.1

Sequence similarities

Belongs to the PP2C family.

Contains 1 PP2C-like domain.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   LigandMagnesium
Manganese
Metal-binding
   Molecular functionHydrolase
Protein phosphatase
Gene Ontology (GO)
   Biological_processprotein dephosphorylation

Inferred from electronic annotation. Source: InterPro

   Molecular_functionmetal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

protein serine/threonine phosphatase activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5MFV5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5MFV5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     288-317: TGIANRLVKAALKEATRKREVSFRDLKTIE → TVSSDNIYSIRSFHHREYIFPVNERGVLTQ
     318-380: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q5MFV5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     233-255: VGPPIPLKRPALSAEPSIQVRKL → MVSGSISVTTLRCRLSSRIQGRV
     256-380: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 380380Probable protein phosphatase 2C 34
PRO_0000363280

Regions

Domain26 – 307282PP2C-like

Sites

Metal binding661Manganese 1 By similarity
Metal binding661Manganese 2 By similarity
Metal binding671Manganese 1; via carbonyl oxygen By similarity
Metal binding2671Manganese 2 By similarity
Metal binding3261Manganese 2 By similarity

Natural variations

Alternative sequence233 – 25523VGPPI…QVRKL → MVSGSISVTTLRCRLSSRIQ GRV in isoform 3.
VSP_036259
Alternative sequence256 – 380125Missing in isoform 3.
VSP_036260
Alternative sequence288 – 31730TGIAN…LKTIE → TVSSDNIYSIRSFHHREYIF PVNERGVLTQ in isoform 2.
VSP_036261
Alternative sequence318 – 38063Missing in isoform 2.
VSP_036262

Experimental info

Sequence conflict841H → L in AAW29521. Ref.1
Sequence conflict841H → L in AAW29522. Ref.1
Sequence conflict1751A → T in AAW29521. Ref.1
Sequence conflict1751A → T in AAW29522. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 10, 2009. Version 2.
Checksum: A52FA669C224987F

FASTA38041,754
        10         20         30         40         50         60 
MLRAVARCCG HWPPGAAAAD GMLWQTELRP HAAGEFSMAA AQANLAMEDQ AQVLASPAAT 

        70         80         90        100        110        120 
LVGVYDGHGG ADASRFLRSR LFPHVQRFEK EQGGMSTEVI RRAFGAAEEE FLQQVRQAWR 

       130        140        150        160        170        180 
QRPKMAAVGS CCLLGAISGD TLYVANLGDS RAVLGRRVVG GGVAVAERLT DEHNAASEEV 

       190        200        210        220        230        240 
RRELTALNPD DAQIVVHARG AWRVKGIIQV SRTIGDVYLK KQEYSMDPVF RNVGPPIPLK 

       250        260        270        280        290        300 
RPALSAEPSI QVRKLKPNDL FLIFASDGLW EHLSDDAAVQ IVFKNPRTGI ANRLVKAALK 

       310        320        330        340        350        360 
EATRKREVSF RDLKTIEKGV RRHFHDDISV IVVYLDRHRG RRHTRVVDSS SNCTNAPVDI 

       370        380 
YSSNSGQSVE TLQAHRGSGW 

« Hide

Isoform 2 [UniParc].

Checksum: B3765511788DEA42
Show »

FASTA31734,806
Isoform 3 [UniParc].

Checksum: 9F404754981AA892
Show »

FASTA25527,659

References

« Hide 'large scale' references
[1]"Molecular characterization of four rice genes encoding ethylene-responsive transcriptional factors and their expressions in response to biotic and abiotic stress."
Cao Y., Song F., Goodman R.M., Zheng Z.
J. Plant Physiol. 163:1167-1178(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), INDUCTION.
Strain: cv. Yuanfengzao.
Tissue: Seedling.
[2]"The genomes of Oryza sativa: a history of duplications."
Yu J., Wang J., Lin W., Li S., Li H., Zhou J., Ni P., Dong W., Hu S., Zeng C., Zhang J., Zhang Y., Li R., Xu Z., Li S., Li X., Zheng H., Cong L. expand/collapse author list , Lin L., Yin J., Geng J., Li G., Shi J., Liu J., Lv H., Li J., Wang J., Deng Y., Ran L., Shi X., Wang X., Wu Q., Li C., Ren X., Wang J., Wang X., Li D., Liu D., Zhang X., Ji Z., Zhao W., Sun Y., Zhang Z., Bao J., Han Y., Dong L., Ji J., Chen P., Wu S., Liu J., Xiao Y., Bu D., Tan J., Yang L., Ye C., Zhang J., Xu J., Zhou Y., Yu Y., Zhang B., Zhuang S., Wei H., Liu B., Lei M., Yu H., Li Y., Xu H., Wei S., He X., Fang L., Zhang Z., Zhang Y., Huang X., Su Z., Tong W., Li J., Tong Z., Li S., Ye J., Wang L., Fang L., Lei T., Chen C.-S., Chen H.-C., Xu Z., Li H., Huang H., Zhang F., Xu H., Li N., Zhao C., Li S., Dong L., Huang Y., Li L., Xi Y., Qi Q., Li W., Zhang B., Hu W., Zhang Y., Tian X., Jiao Y., Liang X., Jin J., Gao L., Zheng W., Hao B., Liu S.-M., Wang W., Yuan L., Cao M., McDermott J., Samudrala R., Wang J., Wong G.K.-S., Yang H.
PLoS Biol. 3:266-281(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: cv. 93-11.
[3]"Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis."
Xue T., Wang D., Zhang S., Ehlting J., Ni F., Jacab S., Zheng C., Zhong Y.
BMC Genomics 9:550-550(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: GENE FAMILY, NOMENCLATURE.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY831390 mRNA. Translation: AAW29521.1.
AY831391 mRNA. Translation: AAW29522.1.
CM000128 Genomic DNA. No translation available.

3D structure databases

ProteinModelPortalQ5MFV5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING39946.BGIOSIBCE013047.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Organism-specific databases

GrameneQ5MFV5.

Phylogenomic databases

eggNOGCOG0631.
HOGENOMHOG000238703.

Family and domain databases

Gene3D3.60.40.10. 1 hit.
InterProIPR001932. PP2C-like_dom.
IPR000222. PP2C_Mn2_Asp60_BS.
IPR015655. Protein_Pase_2C.
[Graphical view]
PANTHERPTHR13832. PTHR13832. 1 hit.
PfamPF00481. PP2C. 1 hit.
[Graphical view]
SMARTSM00331. PP2C_SIG. 1 hit.
SM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMSSF81606. SSF81606. 1 hit.
PROSITEPS01032. PP2C. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry nameP2C34_ORYSI
AccessionPrimary (citable) accession number: Q5MFV5
Secondary accession number(s): A2XM81, Q5MFV4
Entry history
Integrated into UniProtKB/Swiss-Prot: February 10, 2009
Last sequence update: February 10, 2009
Last modified: April 16, 2014
This is version 50 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families