SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5MFV5

- P2C34_ORYSI

UniProt

Q5MFV5 - P2C34_ORYSI

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Probable protein phosphatase 2C 34

Gene
BIPP2C2, OsI_013174
Organism
Oryza sativa subsp. indica (Rice)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Catalytic activityi

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactori

Binds 2 magnesium or manganese ions per subunit By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi66 – 661Manganese 1 By similarity
Metal bindingi66 – 661Manganese 2 By similarity
Metal bindingi67 – 671Manganese 1; via carbonyl oxygen By similarity
Metal bindingi267 – 2671Manganese 2 By similarity
Metal bindingi326 – 3261Manganese 2 By similarity

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. protein serine/threonine phosphatase activity Source: InterPro

GO - Biological processi

  1. protein dephosphorylation Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Magnesium, Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable protein phosphatase 2C 34 (EC:3.1.3.16)
Short name:
OsPP2C34
Alternative name(s):
BTH-induced protein phosphatase 2C 2
Short name:
OsBIPP2C2
Gene namesi
Name:BIPP2C2
ORF Names:OsI_013174
OrganismiOryza sativa subsp. indica (Rice)
Taxonomic identifieri39946 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaLiliopsidaPoalesPoaceaeBEP cladeEhrhartoideaeOryzeaeOryza

Organism-specific databases

GrameneiQ5MFV5.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 380380Probable protein phosphatase 2C 34PRO_0000363280Add
BLAST

Expressioni

Inductioni

By benzothiadiazole (BTH).1 Publication

Interactioni

Protein-protein interaction databases

STRINGi39946.BGIOSIBCE013047.

Structurei

3D structure databases

ProteinModelPortaliQ5MFV5.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini26 – 307282PP2C-likeAdd
BLAST

Sequence similaritiesi

Belongs to the PP2C family.
Contains 1 PP2C-like domain.

Phylogenomic databases

eggNOGiCOG0631.
HOGENOMiHOG000238703.

Family and domain databases

Gene3Di3.60.40.10. 1 hit.
InterProiIPR001932. PP2C-like_dom.
IPR000222. PP2C_Mn2_Asp60_BS.
IPR015655. Protein_Pase_2C.
[Graphical view]
PANTHERiPTHR13832. PTHR13832. 1 hit.
PfamiPF00481. PP2C. 1 hit.
[Graphical view]
SMARTiSM00331. PP2C_SIG. 1 hit.
SM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMiSSF81606. SSF81606. 1 hit.
PROSITEiPS01032. PP2C. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5MFV5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLRAVARCCG HWPPGAAAAD GMLWQTELRP HAAGEFSMAA AQANLAMEDQ    50
AQVLASPAAT LVGVYDGHGG ADASRFLRSR LFPHVQRFEK EQGGMSTEVI 100
RRAFGAAEEE FLQQVRQAWR QRPKMAAVGS CCLLGAISGD TLYVANLGDS 150
RAVLGRRVVG GGVAVAERLT DEHNAASEEV RRELTALNPD DAQIVVHARG 200
AWRVKGIIQV SRTIGDVYLK KQEYSMDPVF RNVGPPIPLK RPALSAEPSI 250
QVRKLKPNDL FLIFASDGLW EHLSDDAAVQ IVFKNPRTGI ANRLVKAALK 300
EATRKREVSF RDLKTIEKGV RRHFHDDISV IVVYLDRHRG RRHTRVVDSS 350
SNCTNAPVDI YSSNSGQSVE TLQAHRGSGW 380
Length:380
Mass (Da):41,754
Last modified:February 10, 2009 - v2
Checksum:iA52FA669C224987F
GO
Isoform 2 (identifier: Q5MFV5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     288-317: TGIANRLVKAALKEATRKREVSFRDLKTIE → TVSSDNIYSIRSFHHREYIFPVNERGVLTQ
     318-380: Missing.

Note: No experimental confirmation available.

Show »
Length:317
Mass (Da):34,806
Checksum:iB3765511788DEA42
GO
Isoform 3 (identifier: Q5MFV5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-255: VGPPIPLKRPALSAEPSIQVRKL → MVSGSISVTTLRCRLSSRIQGRV
     256-380: Missing.

Note: No experimental confirmation available.

Show »
Length:255
Mass (Da):27,659
Checksum:i9F404754981AA892
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei233 – 25523VGPPI…QVRKL → MVSGSISVTTLRCRLSSRIQ GRV in isoform 3. VSP_036259Add
BLAST
Alternative sequencei256 – 380125Missing in isoform 3. VSP_036260Add
BLAST
Alternative sequencei288 – 31730TGIAN…LKTIE → TVSSDNIYSIRSFHHREYIF PVNERGVLTQ in isoform 2. VSP_036261Add
BLAST
Alternative sequencei318 – 38063Missing in isoform 2. VSP_036262Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti84 – 841H → L in AAW29521. 1 Publication
Sequence conflicti84 – 841H → L in AAW29522. 1 Publication
Sequence conflicti175 – 1751A → T in AAW29521. 1 Publication
Sequence conflicti175 – 1751A → T in AAW29522. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY831390 mRNA. Translation: AAW29521.1.
AY831391 mRNA. Translation: AAW29522.1.
CM000128 Genomic DNA. No translation available.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY831390 mRNA. Translation: AAW29521.1 .
AY831391 mRNA. Translation: AAW29522.1 .
CM000128 Genomic DNA. No translation available.

3D structure databases

ProteinModelPortali Q5MFV5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 39946.BGIOSIBCE013047.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Organism-specific databases

Gramenei Q5MFV5.

Phylogenomic databases

eggNOGi COG0631.
HOGENOMi HOG000238703.

Family and domain databases

Gene3Di 3.60.40.10. 1 hit.
InterProi IPR001932. PP2C-like_dom.
IPR000222. PP2C_Mn2_Asp60_BS.
IPR015655. Protein_Pase_2C.
[Graphical view ]
PANTHERi PTHR13832. PTHR13832. 1 hit.
Pfami PF00481. PP2C. 1 hit.
[Graphical view ]
SMARTi SM00331. PP2C_SIG. 1 hit.
SM00332. PP2Cc. 1 hit.
[Graphical view ]
SUPFAMi SSF81606. SSF81606. 1 hit.
PROSITEi PS01032. PP2C. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular characterization of four rice genes encoding ethylene-responsive transcriptional factors and their expressions in response to biotic and abiotic stress."
    Cao Y., Song F., Goodman R.M., Zheng Z.
    J. Plant Physiol. 163:1167-1178(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), INDUCTION.
    Strain: cv. Yuanfengzao.
    Tissue: Seedling.
  2. "The genomes of Oryza sativa: a history of duplications."
    Yu J., Wang J., Lin W., Li S., Li H., Zhou J., Ni P., Dong W., Hu S., Zeng C., Zhang J., Zhang Y., Li R., Xu Z., Li S., Li X., Zheng H., Cong L.
    , Lin L., Yin J., Geng J., Li G., Shi J., Liu J., Lv H., Li J., Wang J., Deng Y., Ran L., Shi X., Wang X., Wu Q., Li C., Ren X., Wang J., Wang X., Li D., Liu D., Zhang X., Ji Z., Zhao W., Sun Y., Zhang Z., Bao J., Han Y., Dong L., Ji J., Chen P., Wu S., Liu J., Xiao Y., Bu D., Tan J., Yang L., Ye C., Zhang J., Xu J., Zhou Y., Yu Y., Zhang B., Zhuang S., Wei H., Liu B., Lei M., Yu H., Li Y., Xu H., Wei S., He X., Fang L., Zhang Z., Zhang Y., Huang X., Su Z., Tong W., Li J., Tong Z., Li S., Ye J., Wang L., Fang L., Lei T., Chen C.-S., Chen H.-C., Xu Z., Li H., Huang H., Zhang F., Xu H., Li N., Zhao C., Li S., Dong L., Huang Y., Li L., Xi Y., Qi Q., Li W., Zhang B., Hu W., Zhang Y., Tian X., Jiao Y., Liang X., Jin J., Gao L., Zheng W., Hao B., Liu S.-M., Wang W., Yuan L., Cao M., McDermott J., Samudrala R., Wang J., Wong G.K.-S., Yang H.
    PLoS Biol. 3:266-281(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. 93-11.
  3. "Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis."
    Xue T., Wang D., Zhang S., Ehlting J., Ni F., Jacab S., Zheng C., Zhong Y.
    BMC Genomics 9:550-550(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: GENE FAMILY, NOMENCLATURE.

Entry informationi

Entry nameiP2C34_ORYSI
AccessioniPrimary (citable) accession number: Q5MFV5
Secondary accession number(s): A2XM81, Q5MFV4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 10, 2009
Last sequence update: February 10, 2009
Last modified: April 16, 2014
This is version 50 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi