Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase-like 4

Gene

CDKL4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei33ATPPROSITE-ProRule annotation1
Active sitei126Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi10 – 18ATPPROSITE-ProRule annotation9

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:G66-32301-MONOMER.
SignaLinkiQ5MAI5.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase-like 4 (EC:2.7.11.22)
Gene namesi
Name:CDKL4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:19287. CDKL4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi344387.
OpenTargetsiENSG00000205111.
PharmGKBiPA134892546.

Chemistry databases

GuidetoPHARMACOLOGYi1985.

Polymorphism and mutation databases

BioMutaiCDKL4.
DMDMi74762208.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000858241 – 379Cyclin-dependent kinase-like 4Add BLAST379

Proteomic databases

PaxDbiQ5MAI5.
PeptideAtlasiQ5MAI5.
PRIDEiQ5MAI5.

PTM databases

iPTMnetiQ5MAI5.
PhosphoSitePlusiQ5MAI5.

Expressioni

Gene expression databases

BgeeiENSG00000205111.
CleanExiHS_CDKL4.
ExpressionAtlasiQ5MAI5. baseline and differential.

Organism-specific databases

HPAiHPA067895.

Interactioni

Protein-protein interaction databases

BioGridi131301. 12 interactors.
IntActiQ5MAI5. 1 interactor.

Structurei

3D structure databases

ProteinModelPortaliQ5MAI5.
SMRiQ5MAI5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 286Protein kinasePROSITE-ProRule annotationAdd BLAST283

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi45 – 51[NKR]KIAxRE7

Domaini

The [NKR]KIAxRE motif seems to be a cyclin-binding region.

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0593. Eukaryota.
ENOG410XNSW. LUCA.
GeneTreeiENSGT00830000128262.
HOGENOMiHOG000233024.
HOVERGENiHBG014652.
InParanoidiQ5MAI5.
KOiK08824.
OMAiRNETQTS.
OrthoDBiEOG091G0BZP.
PhylomeDBiQ5MAI5.
TreeFamiTF101031.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5MAI5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKYEKLAKT GEGSYGVVFK CRNKTSGQVV AVKKFVESED DPVVKKIALR
60 70 80 90 100
EIRMLKQLKH PNLVNLIEVF RRKRKMHLVF EYCDHTLLNE LERNPNGVAD
110 120 130 140 150
GVIKSVLWQT LQALNFCHIH NCIHRDIKPE NILITKQGII KICDFGFAQI
160 170 180 190 200
LIPGDAYTDY VATRWYRAPE LLVGDTQYGS SVDIWAIGCV FAELLTGQPL
210 220 230 240 250
WPGKSDVDQL YLIIRTLGKL IPRHQSIFKS NGFFHGISIP EPEDMETLEE
260 270 280 290 300
KFSDVHPVAL NFMKGCLKMN PDDRLTCSQL LESSYFDSFQ EAQIKRKARN
310 320 330 340 350
EGRNRRRQQQ APKSAFPRLF LKTKICQVQR NETQTSGNQI LPNGPILQNS
360 370
MVTVMTNINS AVYQVTVLHL LSENFEVKS
Length:379
Mass (Da):43,384
Last modified:July 9, 2014 - v2
Checksum:i95B4783DA12B0C4A
GO
Isoform 2 (identifier: Q5MAI5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     310-377: QAPKSAFPRLFLKTKICQVQRNETQTSGNQILPNGPILQNSMVTVMTNINSAVYQVTVLHLLSENFEV → VLPL

Show »
Length:315
Mass (Da):36,223
Checksum:iC40EFF6A79FF5966
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04199238S → P.1 PublicationCorresponds to variant rs35947084dbSNPEnsembl.1
Natural variantiVAR_04199353R → H.1 PublicationCorresponds to variant rs35454041dbSNPEnsembl.1
Natural variantiVAR_053930118H → Y.Corresponds to variant rs6731369dbSNPEnsembl.1
Natural variantiVAR_041994228F → C.1 PublicationCorresponds to variant rs56353587dbSNPEnsembl.1
Natural variantiVAR_041995288S → Y.1 PublicationCorresponds to variant rs34819676dbSNPEnsembl.1
Natural variantiVAR_041996307R → C.1 PublicationCorresponds to variant rs56330730dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055220310 – 377QAPKS…ENFEV → VLPL in isoform 2. 1 PublicationAdd BLAST68

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY845084 mRNA. Translation: AAW30008.1.
AY847283 mRNA. Translation: AAW31760.1.
AC079615 Genomic DNA. No translation available.
AC092672 Genomic DNA. No translation available.
CCDSiCCDS33184.1. [Q5MAI5-2]
RefSeqiNP_001009565.1. NM_001009565.1. [Q5MAI5-2]
XP_011531117.1. XM_011532815.2. [Q5MAI5-1]
UniGeneiHs.403201.

Genome annotation databases

EnsembliENST00000378803; ENSP00000368080; ENSG00000205111. [Q5MAI5-2]
ENST00000395035; ENSP00000378476; ENSG00000205111. [Q5MAI5-1]
GeneIDi344387.
KEGGihsa:344387.
UCSCiuc002rrm.3. human. [Q5MAI5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY845084 mRNA. Translation: AAW30008.1.
AY847283 mRNA. Translation: AAW31760.1.
AC079615 Genomic DNA. No translation available.
AC092672 Genomic DNA. No translation available.
CCDSiCCDS33184.1. [Q5MAI5-2]
RefSeqiNP_001009565.1. NM_001009565.1. [Q5MAI5-2]
XP_011531117.1. XM_011532815.2. [Q5MAI5-1]
UniGeneiHs.403201.

3D structure databases

ProteinModelPortaliQ5MAI5.
SMRiQ5MAI5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131301. 12 interactors.
IntActiQ5MAI5. 1 interactor.

Chemistry databases

GuidetoPHARMACOLOGYi1985.

PTM databases

iPTMnetiQ5MAI5.
PhosphoSitePlusiQ5MAI5.

Polymorphism and mutation databases

BioMutaiCDKL4.
DMDMi74762208.

Proteomic databases

PaxDbiQ5MAI5.
PeptideAtlasiQ5MAI5.
PRIDEiQ5MAI5.

Protocols and materials databases

DNASUi344387.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000378803; ENSP00000368080; ENSG00000205111. [Q5MAI5-2]
ENST00000395035; ENSP00000378476; ENSG00000205111. [Q5MAI5-1]
GeneIDi344387.
KEGGihsa:344387.
UCSCiuc002rrm.3. human. [Q5MAI5-1]

Organism-specific databases

CTDi344387.
DisGeNETi344387.
GeneCardsiCDKL4.
HGNCiHGNC:19287. CDKL4.
HPAiHPA067895.
neXtProtiNX_Q5MAI5.
OpenTargetsiENSG00000205111.
PharmGKBiPA134892546.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0593. Eukaryota.
ENOG410XNSW. LUCA.
GeneTreeiENSGT00830000128262.
HOGENOMiHOG000233024.
HOVERGENiHBG014652.
InParanoidiQ5MAI5.
KOiK08824.
OMAiRNETQTS.
OrthoDBiEOG091G0BZP.
PhylomeDBiQ5MAI5.
TreeFamiTF101031.

Enzyme and pathway databases

BioCyciZFISH:G66-32301-MONOMER.
SignaLinkiQ5MAI5.

Miscellaneous databases

ChiTaRSiCDKL4. human.
GenomeRNAii344387.
PROiQ5MAI5.

Gene expression databases

BgeeiENSG00000205111.
CleanExiHS_CDKL4.
ExpressionAtlasiQ5MAI5. baseline and differential.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCDKL4_HUMAN
AccessioniPrimary (citable) accession number: Q5MAI5
Secondary accession number(s): Q2NME9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: July 9, 2014
Last modified: November 30, 2016
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.