Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5MAI5

- CDKL4_HUMAN

UniProt

Q5MAI5 - CDKL4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cyclin-dependent kinase-like 4

Gene

CDKL4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei33 – 331ATPPROSITE-ProRule annotation
Active sitei126 – 1261Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi10 – 189ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB-EC
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ5MAI5.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase-like 4 (EC:2.7.11.22)
Gene namesi
Name:CDKL4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:19287. CDKL4.

Subcellular locationi

Cytoplasm Curated

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134892546.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 379379Cyclin-dependent kinase-like 4PRO_0000085824Add
BLAST

Proteomic databases

PaxDbiQ5MAI5.
PRIDEiQ5MAI5.

PTM databases

PhosphoSiteiQ5MAI5.

Expressioni

Gene expression databases

BgeeiQ5MAI5.
CleanExiHS_CDKL4.
ExpressionAtlasiQ5MAI5. baseline.
GenevestigatoriQ5MAI5.

Interactioni

Protein-protein interaction databases

BioGridi131301. 10 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ5MAI5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 286283Protein kinasePROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi45 – 517[NKR]KIAxRE

Domaini

The [NKR]KIAxRE motif seems to be a cyclin-binding region.

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00760000119242.
HOGENOMiHOG000233024.
HOVERGENiHBG014652.
InParanoidiQ5MAI5.
KOiK08824.
PhylomeDBiQ5MAI5.
TreeFamiTF101031.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5MAI5) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKYEKLAKT GEGSYGVVFK CRNKTSGQVV AVKKFVESED DPVVKKIALR
60 70 80 90 100
EIRMLKQLKH PNLVNLIEVF RRKRKMHLVF EYCDHTLLNE LERNPNGVAD
110 120 130 140 150
GVIKSVLWQT LQALNFCHIH NCIHRDIKPE NILITKQGII KICDFGFAQI
160 170 180 190 200
LIPGDAYTDY VATRWYRAPE LLVGDTQYGS SVDIWAIGCV FAELLTGQPL
210 220 230 240 250
WPGKSDVDQL YLIIRTLGKL IPRHQSIFKS NGFFHGISIP EPEDMETLEE
260 270 280 290 300
KFSDVHPVAL NFMKGCLKMN PDDRLTCSQL LESSYFDSFQ EAQIKRKARN
310 320 330 340 350
EGRNRRRQQQ APKSAFPRLF LKTKICQVQR NETQTSGNQI LPNGPILQNS
360 370
MVTVMTNINS AVYQVTVLHL LSENFEVKS
Length:379
Mass (Da):43,384
Last modified:July 9, 2014 - v2
Checksum:i95B4783DA12B0C4A
GO
Isoform 2 (identifier: Q5MAI5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     310-377: QAPKSAFPRLFLKTKICQVQRNETQTSGNQILPNGPILQNSMVTVMTNINSAVYQVTVLHLLSENFEV → VLPL

Show »
Length:315
Mass (Da):36,223
Checksum:iC40EFF6A79FF5966
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti38 – 381S → P.1 Publication
Corresponds to variant rs35947084 [ dbSNP | Ensembl ].
VAR_041992
Natural varianti53 – 531R → H.1 Publication
Corresponds to variant rs35454041 [ dbSNP | Ensembl ].
VAR_041993
Natural varianti118 – 1181H → Y.
Corresponds to variant rs6731369 [ dbSNP | Ensembl ].
VAR_053930
Natural varianti228 – 2281F → C.1 Publication
Corresponds to variant rs56353587 [ dbSNP | Ensembl ].
VAR_041994
Natural varianti288 – 2881S → Y.1 Publication
Corresponds to variant rs34819676 [ dbSNP | Ensembl ].
VAR_041995
Natural varianti307 – 3071R → C.1 Publication
Corresponds to variant rs56330730 [ dbSNP | Ensembl ].
VAR_041996

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei310 – 37768QAPKS…ENFEV → VLPL in isoform 2. 1 PublicationVSP_055220Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY845084 mRNA. Translation: AAW30008.1.
AY847283 mRNA. Translation: AAW31760.1.
AC079615 Genomic DNA. No translation available.
AC092672 Genomic DNA. No translation available.
CCDSiCCDS33184.1. [Q5MAI5-2]
RefSeqiNP_001009565.1. NM_001009565.1. [Q5MAI5-2]
UniGeneiHs.403201.

Genome annotation databases

EnsembliENST00000378803; ENSP00000368080; ENSG00000205111. [Q5MAI5-2]
ENST00000395035; ENSP00000378476; ENSG00000205111. [Q5MAI5-1]
GeneIDi344387.
KEGGihsa:344387.
UCSCiuc002rrm.3. human. [Q5MAI5-1]
uc010fal.2. human.

Polymorphism databases

DMDMi74762208.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY845084 mRNA. Translation: AAW30008.1 .
AY847283 mRNA. Translation: AAW31760.1 .
AC079615 Genomic DNA. No translation available.
AC092672 Genomic DNA. No translation available.
CCDSi CCDS33184.1. [Q5MAI5-2 ]
RefSeqi NP_001009565.1. NM_001009565.1. [Q5MAI5-2 ]
UniGenei Hs.403201.

3D structure databases

ProteinModelPortali Q5MAI5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 131301. 10 interactions.

Chemistry

GuidetoPHARMACOLOGYi 1985.

PTM databases

PhosphoSitei Q5MAI5.

Polymorphism databases

DMDMi 74762208.

Proteomic databases

PaxDbi Q5MAI5.
PRIDEi Q5MAI5.

Protocols and materials databases

DNASUi 344387.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000378803 ; ENSP00000368080 ; ENSG00000205111 . [Q5MAI5-2 ]
ENST00000395035 ; ENSP00000378476 ; ENSG00000205111 . [Q5MAI5-1 ]
GeneIDi 344387.
KEGGi hsa:344387.
UCSCi uc002rrm.3. human. [Q5MAI5-1 ]
uc010fal.2. human.

Organism-specific databases

CTDi 344387.
GeneCardsi GC02M039402.
HGNCi HGNC:19287. CDKL4.
neXtProti NX_Q5MAI5.
PharmGKBi PA134892546.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00760000119242.
HOGENOMi HOG000233024.
HOVERGENi HBG014652.
InParanoidi Q5MAI5.
KOi K08824.
PhylomeDBi Q5MAI5.
TreeFami TF101031.

Enzyme and pathway databases

SignaLinki Q5MAI5.

Miscellaneous databases

GenomeRNAii 344387.
NextBioi 98684.
PROi Q5MAI5.

Gene expression databases

Bgeei Q5MAI5.
CleanExi HS_CDKL4.
ExpressionAtlasi Q5MAI5. baseline.
Genevestigatori Q5MAI5.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF00069. Pkinase. 1 hit.
[Graphical view ]
SMARTi SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of human cyclin-dependent kinase-like 4."
    Wang P.Z., Wang F., Wang X., Wu J.
    Submitted (DEC-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] PRO-38; HIS-53; CYS-228; TYR-288 AND CYS-307.

Entry informationi

Entry nameiCDKL4_HUMAN
AccessioniPrimary (citable) accession number: Q5MAI5
Secondary accession number(s): Q2NME9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: July 9, 2014
Last modified: October 29, 2014
This is version 87 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3