Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5MAI5

- CDKL4_HUMAN

UniProt

Q5MAI5 - CDKL4_HUMAN

Protein

Cyclin-dependent kinase-like 4

Gene

CDKL4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 86 (01 Oct 2014)
      Sequence version 2 (09 Jul 2014)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei33 – 331ATPPROSITE-ProRule annotation
    Active sitei126 – 1261Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi10 – 189ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB-EC

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    SignaLinkiQ5MAI5.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cyclin-dependent kinase-like 4 (EC:2.7.11.22)
    Gene namesi
    Name:CDKL4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:19287. CDKL4.

    Subcellular locationi

    Cytoplasm Curated

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134892546.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 379379Cyclin-dependent kinase-like 4PRO_0000085824Add
    BLAST

    Proteomic databases

    PaxDbiQ5MAI5.
    PRIDEiQ5MAI5.

    PTM databases

    PhosphoSiteiQ5MAI5.

    Expressioni

    Gene expression databases

    BgeeiQ5MAI5.
    CleanExiHS_CDKL4.
    GenevestigatoriQ5MAI5.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5MAI5.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini4 – 286283Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi45 – 517[NKR]KIAxRE

    Domaini

    The [NKR]KIAxRE motif seems to be a cyclin-binding region.

    Sequence similaritiesi

    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    HOGENOMiHOG000233024.
    HOVERGENiHBG014652.
    KOiK08824.
    PhylomeDBiQ5MAI5.
    TreeFamiTF101031.

    Family and domain databases

    InterProiIPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view]
    PfamiPF00069. Pkinase. 1 hit.
    [Graphical view]
    SMARTiSM00220. S_TKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5MAI5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEKYEKLAKT GEGSYGVVFK CRNKTSGQVV AVKKFVESED DPVVKKIALR    50
    EIRMLKQLKH PNLVNLIEVF RRKRKMHLVF EYCDHTLLNE LERNPNGVAD 100
    GVIKSVLWQT LQALNFCHIH NCIHRDIKPE NILITKQGII KICDFGFAQI 150
    LIPGDAYTDY VATRWYRAPE LLVGDTQYGS SVDIWAIGCV FAELLTGQPL 200
    WPGKSDVDQL YLIIRTLGKL IPRHQSIFKS NGFFHGISIP EPEDMETLEE 250
    KFSDVHPVAL NFMKGCLKMN PDDRLTCSQL LESSYFDSFQ EAQIKRKARN 300
    EGRNRRRQQQ APKSAFPRLF LKTKICQVQR NETQTSGNQI LPNGPILQNS 350
    MVTVMTNINS AVYQVTVLHL LSENFEVKS 379
    Length:379
    Mass (Da):43,384
    Last modified:July 9, 2014 - v2
    Checksum:i95B4783DA12B0C4A
    GO
    Isoform 2 (identifier: Q5MAI5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         310-377: QAPKSAFPRLFLKTKICQVQRNETQTSGNQILPNGPILQNSMVTVMTNINSAVYQVTVLHLLSENFEV → VLPL

    Show »
    Length:315
    Mass (Da):36,223
    Checksum:iC40EFF6A79FF5966
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti38 – 381S → P.1 Publication
    Corresponds to variant rs35947084 [ dbSNP | Ensembl ].
    VAR_041992
    Natural varianti53 – 531R → H.1 Publication
    Corresponds to variant rs35454041 [ dbSNP | Ensembl ].
    VAR_041993
    Natural varianti118 – 1181H → Y.
    Corresponds to variant rs6731369 [ dbSNP | Ensembl ].
    VAR_053930
    Natural varianti228 – 2281F → C.1 Publication
    Corresponds to variant rs56353587 [ dbSNP | Ensembl ].
    VAR_041994
    Natural varianti288 – 2881S → Y.1 Publication
    Corresponds to variant rs34819676 [ dbSNP | Ensembl ].
    VAR_041995
    Natural varianti307 – 3071R → C.1 Publication
    Corresponds to variant rs56330730 [ dbSNP | Ensembl ].
    VAR_041996

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei310 – 37768QAPKS…ENFEV → VLPL in isoform 2. 1 PublicationVSP_055220Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY845084 mRNA. Translation: AAW30008.1.
    AY847283 mRNA. Translation: AAW31760.1.
    AC079615 Genomic DNA. No translation available.
    AC092672 Genomic DNA. No translation available.
    CCDSiCCDS33184.1. [Q5MAI5-2]
    RefSeqiNP_001009565.1. NM_001009565.1.
    UniGeneiHs.403201.

    Genome annotation databases

    EnsembliENST00000378803; ENSP00000368080; ENSG00000205111. [Q5MAI5-2]
    ENST00000395035; ENSP00000378476; ENSG00000205111. [Q5MAI5-1]
    GeneIDi344387.
    KEGGihsa:344387.
    UCSCiuc002rrm.3. human. [Q5MAI5-1]

    Polymorphism databases

    DMDMi74762208.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY845084 mRNA. Translation: AAW30008.1 .
    AY847283 mRNA. Translation: AAW31760.1 .
    AC079615 Genomic DNA. No translation available.
    AC092672 Genomic DNA. No translation available.
    CCDSi CCDS33184.1. [Q5MAI5-2 ]
    RefSeqi NP_001009565.1. NM_001009565.1.
    UniGenei Hs.403201.

    3D structure databases

    ProteinModelPortali Q5MAI5.
    ModBasei Search...
    MobiDBi Search...

    Chemistry

    GuidetoPHARMACOLOGYi 1985.

    PTM databases

    PhosphoSitei Q5MAI5.

    Polymorphism databases

    DMDMi 74762208.

    Proteomic databases

    PaxDbi Q5MAI5.
    PRIDEi Q5MAI5.

    Protocols and materials databases

    DNASUi 344387.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000378803 ; ENSP00000368080 ; ENSG00000205111 . [Q5MAI5-2 ]
    ENST00000395035 ; ENSP00000378476 ; ENSG00000205111 . [Q5MAI5-1 ]
    GeneIDi 344387.
    KEGGi hsa:344387.
    UCSCi uc002rrm.3. human. [Q5MAI5-1 ]

    Organism-specific databases

    CTDi 344387.
    GeneCardsi GC02M039402.
    HGNCi HGNC:19287. CDKL4.
    neXtProti NX_Q5MAI5.
    PharmGKBi PA134892546.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOGENOMi HOG000233024.
    HOVERGENi HBG014652.
    KOi K08824.
    PhylomeDBi Q5MAI5.
    TreeFami TF101031.

    Enzyme and pathway databases

    SignaLinki Q5MAI5.

    Miscellaneous databases

    GenomeRNAii 344387.
    NextBioi 98684.
    PROi Q5MAI5.

    Gene expression databases

    Bgeei Q5MAI5.
    CleanExi HS_CDKL4.
    Genevestigatori Q5MAI5.

    Family and domain databases

    InterProi IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view ]
    Pfami PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SMARTi SM00220. S_TKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of human cyclin-dependent kinase-like 4."
      Wang P.Z., Wang F., Wang X., Wu J.
      Submitted (DEC-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] PRO-38; HIS-53; CYS-228; TYR-288 AND CYS-307.

    Entry informationi

    Entry nameiCDKL4_HUMAN
    AccessioniPrimary (citable) accession number: Q5MAI5
    Secondary accession number(s): Q2NME9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 22, 2005
    Last sequence update: July 9, 2014
    Last modified: October 1, 2014
    This is version 86 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3