Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5JVF3

- PCID2_HUMAN

UniProt

Q5JVF3 - PCID2_HUMAN

Protein

PCI domain-containing protein 2

Gene

PCID2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 94 (01 Oct 2014)
      Sequence version 2 (10 Jan 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Required for B-cell survival through the regulation of the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation.By similarity

    GO - Biological processi

    1. negative regulation of apoptotic process Source: UniProtKB
    2. negative regulation of cysteine-type endopeptidase activity Source: UniProtKB
    3. positive regulation of B cell differentiation Source: Ensembl
    4. positive regulation of mitotic cell cycle spindle assembly checkpoint Source: UniProtKB
    5. positive regulation of transcription, DNA-templated Source: UniProtKB
    6. regulation of mRNA stability Source: UniProtKB
    7. spleen development Source: UniProtKB

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    PCI domain-containing protein 2
    Alternative name(s):
    CSN12-like protein
    Gene namesi
    Name:PCID2
    ORF Names:HT004
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 13

    Organism-specific databases

    HGNCiHGNC:25653. PCID2.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA144596397.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 399398PCI domain-containing protein 2PRO_0000121029Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ5JVF3.
    PaxDbiQ5JVF3.
    PRIDEiQ5JVF3.

    PTM databases

    PhosphoSiteiQ5JVF3.

    Expressioni

    Gene expression databases

    BgeeiQ5JVF3.
    CleanExiHS_PCID2.
    GenevestigatoriQ5JVF3.

    Interactioni

    Protein-protein interaction databases

    BioGridi120908. 7 interactions.
    DIPiDIP-50497N.
    IntActiQ5JVF3. 5 interactions.

    Structurei

    Secondary structure

    1
    399
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi206 – 22217
    Helixi226 – 23914
    Helixi245 – 26117
    Helixi268 – 2736
    Helixi277 – 2793
    Helixi280 – 2889
    Helixi291 – 30010
    Helixi302 – 3076
    Helixi311 – 3155
    Helixi317 – 33317
    Beta strandi336 – 3394
    Helixi340 – 34910
    Helixi357 – 36913
    Beta strandi375 – 3784
    Turni379 – 3824
    Beta strandi383 – 3864
    Helixi395 – 3973

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3T5XX-ray2.12A201-399[»]
    ProteinModelPortaliQ5JVF3.
    SMRiQ5JVF3. Positions 168-399.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini277 – 388112PCIAdd
    BLAST

    Sequence similaritiesi

    Belongs to the CSN12 family.Curated
    Contains 1 PCI domain.Curated

    Phylogenomic databases

    eggNOGiCOG5600.
    HOVERGENiHBG055800.
    OMAiPIMYAVA.
    OrthoDBiEOG7TTQ7S.
    PhylomeDBiQ5JVF3.
    TreeFamiTF106136.

    Family and domain databases

    InterProiIPR013143. PAM.
    IPR000717. PCI_dom.
    [Graphical view]
    PfamiPF01399. PCI. 1 hit.
    [Graphical view]
    SMARTiSM00753. PAM. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5JVF3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAHITINQYL QQVYEAIDSR DGASCAELVS FKHPHVANPR LQMASPEEKC    50
    QQVLEPPYDE MFAAHLRCTY AVGNHDFIEA YKCQTVIVQS FLRAFQAHKE 100
    ENWALPVMYA VALDLRVFAN NADQQLVKKG KSKVGDMLEK AAELLMSCFR 150
    VCASDTRAGI EDSKKWGMLF LVNQLFKIYF KINKLHLCKP LIRAIDSSNL 200
    KDDYSTAQRV TYKYYVGRKA MFDSDFKQAE EYLSFAFEHC HRSSQKNKRM 250
    ILIYLLPVKM LLGHMPTVEL LKKYHLMQFA EVTRAVSEGN LLLLHEALAK 300
    HEAFFIRCGI FLILEKLKII TYRNLFKKVY LLLKTHQLSL DAFLVALKFM 350
    QVEDVDIDEV QCILANLIYM GHVKGYISHQ HQKLVVSKQN PFPPLSTVC 399
    Length:399
    Mass (Da):46,030
    Last modified:January 10, 2006 - v2
    Checksum:i8D23273361F00E18
    GO
    Isoform 2 (identifier: Q5JVF3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-12: MAHITINQYLQQ → MRLTDVVQQL

    Note: No experimental confirmation available.

    Show »
    Length:397
    Mass (Da):45,773
    Checksum:i785FD46B5D72AF70
    GO
    Isoform 3 (identifier: Q5JVF3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         92-114: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:376
    Mass (Da):43,375
    Checksum:i039E8F8B8192F3C1
    GO
    Isoform 4 (identifier: Q5JVF3-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         89-89: Q → QYPLSFMAAVPHRTHAVDYLGLETRKHWASCSFLQLERNDSVLEQKLVSALSLGT

    Note: No experimental confirmation available.

    Show »
    Length:453
    Mass (Da):52,100
    Checksum:i57BB6C3A1E85A059
    GO

    Sequence cautioni

    The sequence AAG09695.1 differs from that shown. Reason: Frameshift at position 48.
    The sequence BAB15768.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti74 – 741N → D in AAH31246. (PubMed:15489334)Curated
    Sequence conflicti87 – 871I → L in BAA91407. (PubMed:14702039)Curated
    Sequence conflicti106 – 1061P → L in AAG09695. 1 PublicationCurated
    Sequence conflicti129 – 1291K → E in AAG09695. 1 PublicationCurated
    Sequence conflicti145 – 1451L → M in BAA91407. (PubMed:14702039)Curated
    Sequence conflicti180 – 1801F → I in BAA91611. (PubMed:14702039)Curated
    Sequence conflicti313 – 3131I → T in BAA92118. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1212MAHIT…QYLQQ → MRLTDVVQQL in isoform 2. 1 PublicationVSP_016843Add
    BLAST
    Alternative sequencei89 – 891Q → QYPLSFMAAVPHRTHAVDYL GLETRKHWASCSFLQLERND SVLEQKLVSALSLGT in isoform 4. 1 PublicationVSP_016844
    Alternative sequencei92 – 11423Missing in isoform 3. 1 PublicationVSP_016845Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000888 mRNA. Translation: BAA91407.1.
    AK001185 mRNA. Translation: BAA91542.1.
    AK001302 mRNA. Translation: BAA91611.1.
    AK002167 mRNA. Translation: BAA92118.1.
    AK023313 mRNA. Translation: BAB14521.1.
    AK024478 mRNA. Translation: BAB15768.1. Different initiation.
    AF183426 mRNA. Translation: AAG09695.1. Frameshift.
    AL137002 Genomic DNA. Translation: CAI41391.1.
    AL136221, AL137002 Genomic DNA. Translation: CAI13794.1.
    AL137002, AL136221 Genomic DNA. Translation: CAI41378.1.
    AL136221, AL137002 Genomic DNA. Translation: CAI13793.1.
    AL137002, AL136221 Genomic DNA. Translation: CAI41377.1.
    AL136221, AL137002 Genomic DNA. Translation: CAI13792.1.
    AL137002, AL136221 Genomic DNA. Translation: CAI41379.1.
    BC016614 mRNA. Translation: AAH16614.1.
    BC031246 mRNA. Translation: AAH31246.1.
    CCDSiCCDS58301.1. [Q5JVF3-2]
    CCDS58302.1. [Q5JVF3-4]
    CCDS9532.2. [Q5JVF3-1]
    RefSeqiNP_001120674.1. NM_001127202.2. [Q5JVF3-1]
    NP_001120675.1. NM_001127203.2. [Q5JVF3-1]
    NP_001245141.1. NM_001258212.1. [Q5JVF3-4]
    NP_001245142.1. NM_001258213.1. [Q5JVF3-2]
    NP_060856.2. NM_018386.3. [Q5JVF3-1]
    XP_005268381.1. XM_005268324.1. [Q5JVF3-2]
    UniGeneiHs.508769.

    Genome annotation databases

    EnsembliENST00000246505; ENSP00000246505; ENSG00000126226. [Q5JVF3-4]
    ENST00000337344; ENSP00000337405; ENSG00000126226. [Q5JVF3-1]
    ENST00000375457; ENSP00000364606; ENSG00000126226. [Q5JVF3-2]
    ENST00000375459; ENSP00000364608; ENSG00000126226. [Q5JVF3-2]
    ENST00000375477; ENSP00000364626; ENSG00000126226. [Q5JVF3-1]
    ENST00000375479; ENSP00000364628; ENSG00000126226. [Q5JVF3-1]
    GeneIDi55795.
    KEGGihsa:55795.
    UCSCiuc001vtb.3. human. [Q5JVF3-1]
    uc001vtg.3. human. [Q5JVF3-2]
    uc021rmt.2. human. [Q5JVF3-4]

    Polymorphism databases

    DMDMi85681034.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000888 mRNA. Translation: BAA91407.1 .
    AK001185 mRNA. Translation: BAA91542.1 .
    AK001302 mRNA. Translation: BAA91611.1 .
    AK002167 mRNA. Translation: BAA92118.1 .
    AK023313 mRNA. Translation: BAB14521.1 .
    AK024478 mRNA. Translation: BAB15768.1 . Different initiation.
    AF183426 mRNA. Translation: AAG09695.1 . Frameshift.
    AL137002 Genomic DNA. Translation: CAI41391.1 .
    AL136221 , AL137002 Genomic DNA. Translation: CAI13794.1 .
    AL137002 , AL136221 Genomic DNA. Translation: CAI41378.1 .
    AL136221 , AL137002 Genomic DNA. Translation: CAI13793.1 .
    AL137002 , AL136221 Genomic DNA. Translation: CAI41377.1 .
    AL136221 , AL137002 Genomic DNA. Translation: CAI13792.1 .
    AL137002 , AL136221 Genomic DNA. Translation: CAI41379.1 .
    BC016614 mRNA. Translation: AAH16614.1 .
    BC031246 mRNA. Translation: AAH31246.1 .
    CCDSi CCDS58301.1. [Q5JVF3-2 ]
    CCDS58302.1. [Q5JVF3-4 ]
    CCDS9532.2. [Q5JVF3-1 ]
    RefSeqi NP_001120674.1. NM_001127202.2. [Q5JVF3-1 ]
    NP_001120675.1. NM_001127203.2. [Q5JVF3-1 ]
    NP_001245141.1. NM_001258212.1. [Q5JVF3-4 ]
    NP_001245142.1. NM_001258213.1. [Q5JVF3-2 ]
    NP_060856.2. NM_018386.3. [Q5JVF3-1 ]
    XP_005268381.1. XM_005268324.1. [Q5JVF3-2 ]
    UniGenei Hs.508769.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3T5X X-ray 2.12 A 201-399 [» ]
    ProteinModelPortali Q5JVF3.
    SMRi Q5JVF3. Positions 168-399.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120908. 7 interactions.
    DIPi DIP-50497N.
    IntActi Q5JVF3. 5 interactions.

    PTM databases

    PhosphoSitei Q5JVF3.

    Polymorphism databases

    DMDMi 85681034.

    Proteomic databases

    MaxQBi Q5JVF3.
    PaxDbi Q5JVF3.
    PRIDEi Q5JVF3.

    Protocols and materials databases

    DNASUi 55795.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000246505 ; ENSP00000246505 ; ENSG00000126226 . [Q5JVF3-4 ]
    ENST00000337344 ; ENSP00000337405 ; ENSG00000126226 . [Q5JVF3-1 ]
    ENST00000375457 ; ENSP00000364606 ; ENSG00000126226 . [Q5JVF3-2 ]
    ENST00000375459 ; ENSP00000364608 ; ENSG00000126226 . [Q5JVF3-2 ]
    ENST00000375477 ; ENSP00000364626 ; ENSG00000126226 . [Q5JVF3-1 ]
    ENST00000375479 ; ENSP00000364628 ; ENSG00000126226 . [Q5JVF3-1 ]
    GeneIDi 55795.
    KEGGi hsa:55795.
    UCSCi uc001vtb.3. human. [Q5JVF3-1 ]
    uc001vtg.3. human. [Q5JVF3-2 ]
    uc021rmt.2. human. [Q5JVF3-4 ]

    Organism-specific databases

    CTDi 55795.
    GeneCardsi GC13M113831.
    H-InvDB HIX0130585.
    HGNCi HGNC:25653. PCID2.
    MIMi 613713. gene.
    neXtProti NX_Q5JVF3.
    PharmGKBi PA144596397.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5600.
    HOVERGENi HBG055800.
    OMAi PIMYAVA.
    OrthoDBi EOG7TTQ7S.
    PhylomeDBi Q5JVF3.
    TreeFami TF106136.

    Miscellaneous databases

    GenomeRNAii 55795.
    NextBioi 60919.
    PROi Q5JVF3.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q5JVF3.
    CleanExi HS_PCID2.
    Genevestigatori Q5JVF3.

    Family and domain databases

    InterProi IPR013143. PAM.
    IPR000717. PCI_dom.
    [Graphical view ]
    Pfami PF01399. PCI. 1 hit.
    [Graphical view ]
    SMARTi SM00753. PAM. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
      Tissue: Embryo, Ovary, Placenta, Spleen and Teratocarcinoma.
    2. "A novel gene expressed in human hypothalamus."
      Peng Y., Li N., Jia J., Xu S., Han Z., Fu G., Chen Z.
      Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Hypothalamus.
    3. "The DNA sequence and analysis of human chromosome 13."
      Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
      Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Eye and Testis.
    5. Bienvenut W.V.
      Submitted (JAN-2010) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 2-20; 83-93; 117-128 AND 250-259, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Ovarian carcinoma.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiPCID2_HUMAN
    AccessioniPrimary (citable) accession number: Q5JVF3
    Secondary accession number(s): A6NK09
    , Q3ZCX1, Q5TC57, Q5TC58, Q9H7K1, Q9HBZ7, Q9NUK6, Q9NVY1, Q9NW44, Q9NWH3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 10, 2006
    Last sequence update: January 10, 2006
    Last modified: October 1, 2014
    This is version 94 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 13
      Human chromosome 13: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3