SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5JVF3

- PCID2_HUMAN

UniProt

Q5JVF3 - PCID2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
PCI domain-containing protein 2
Gene
PCID2, HT004
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Required for B-cell survival through the regulation of the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation By similarity.

GO - Biological processi

  1. negative regulation of apoptotic process Source: UniProtKB
  2. negative regulation of cysteine-type endopeptidase activity Source: UniProtKB
  3. positive regulation of B cell differentiation Source: Ensembl
  4. positive regulation of mitotic cell cycle spindle assembly checkpoint Source: UniProtKB
  5. positive regulation of transcription, DNA-templated Source: UniProtKB
  6. regulation of mRNA stability Source: UniProtKB
  7. spleen development Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
PCI domain-containing protein 2
Alternative name(s):
CSN12-like protein
Gene namesi
Name:PCID2
ORF Names:HT004
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 13

Organism-specific databases

HGNCiHGNC:25653. PCID2.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA144596397.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 399398PCI domain-containing protein 2
PRO_0000121029Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ5JVF3.
PaxDbiQ5JVF3.
PRIDEiQ5JVF3.

PTM databases

PhosphoSiteiQ5JVF3.

Expressioni

Gene expression databases

BgeeiQ5JVF3.
CleanExiHS_PCID2.
GenevestigatoriQ5JVF3.

Interactioni

Protein-protein interaction databases

BioGridi120908. 7 interactions.
DIPiDIP-50497N.
IntActiQ5JVF3. 5 interactions.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi206 – 22217
Helixi226 – 23914
Helixi245 – 26117
Helixi268 – 2736
Helixi277 – 2793
Helixi280 – 2889
Helixi291 – 30010
Helixi302 – 3076
Helixi311 – 3155
Helixi317 – 33317
Beta strandi336 – 3394
Helixi340 – 34910
Helixi357 – 36913
Beta strandi375 – 3784
Turni379 – 3824
Beta strandi383 – 3864
Helixi395 – 3973

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3T5XX-ray2.12A201-399[»]
ProteinModelPortaliQ5JVF3.
SMRiQ5JVF3. Positions 168-399.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini277 – 388112PCI
Add
BLAST

Sequence similaritiesi

Belongs to the CSN12 family.
Contains 1 PCI domain.

Phylogenomic databases

eggNOGiCOG5600.
HOVERGENiHBG055800.
OMAiPIMYAVA.
OrthoDBiEOG7TTQ7S.
PhylomeDBiQ5JVF3.
TreeFamiTF106136.

Family and domain databases

InterProiIPR013143. PAM.
IPR000717. PCI_dom.
[Graphical view]
PfamiPF01399. PCI. 1 hit.
[Graphical view]
SMARTiSM00753. PAM. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5JVF3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAHITINQYL QQVYEAIDSR DGASCAELVS FKHPHVANPR LQMASPEEKC    50
QQVLEPPYDE MFAAHLRCTY AVGNHDFIEA YKCQTVIVQS FLRAFQAHKE 100
ENWALPVMYA VALDLRVFAN NADQQLVKKG KSKVGDMLEK AAELLMSCFR 150
VCASDTRAGI EDSKKWGMLF LVNQLFKIYF KINKLHLCKP LIRAIDSSNL 200
KDDYSTAQRV TYKYYVGRKA MFDSDFKQAE EYLSFAFEHC HRSSQKNKRM 250
ILIYLLPVKM LLGHMPTVEL LKKYHLMQFA EVTRAVSEGN LLLLHEALAK 300
HEAFFIRCGI FLILEKLKII TYRNLFKKVY LLLKTHQLSL DAFLVALKFM 350
QVEDVDIDEV QCILANLIYM GHVKGYISHQ HQKLVVSKQN PFPPLSTVC 399
Length:399
Mass (Da):46,030
Last modified:January 10, 2006 - v2
Checksum:i8D23273361F00E18
GO
Isoform 2 (identifier: Q5JVF3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MAHITINQYLQQ → MRLTDVVQQL

Note: No experimental confirmation available.

Show »
Length:397
Mass (Da):45,773
Checksum:i785FD46B5D72AF70
GO
Isoform 3 (identifier: Q5JVF3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-114: Missing.

Note: No experimental confirmation available.

Show »
Length:376
Mass (Da):43,375
Checksum:i039E8F8B8192F3C1
GO
Isoform 4 (identifier: Q5JVF3-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     89-89: Q → QYPLSFMAAVPHRTHAVDYLGLETRKHWASCSFLQLERNDSVLEQKLVSALSLGT

Note: No experimental confirmation available.

Show »
Length:453
Mass (Da):52,100
Checksum:i57BB6C3A1E85A059
GO

Sequence cautioni

The sequence AAG09695.1 differs from that shown. Reason: Frameshift at position 48.
The sequence BAB15768.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1212MAHIT…QYLQQ → MRLTDVVQQL in isoform 2.
VSP_016843Add
BLAST
Alternative sequencei89 – 891Q → QYPLSFMAAVPHRTHAVDYL GLETRKHWASCSFLQLERND SVLEQKLVSALSLGT in isoform 4.
VSP_016844
Alternative sequencei92 – 11423Missing in isoform 3.
VSP_016845Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti74 – 741N → D in AAH31246. 1 Publication
Sequence conflicti87 – 871I → L in BAA91407. 1 Publication
Sequence conflicti106 – 1061P → L in AAG09695. 1 Publication
Sequence conflicti129 – 1291K → E in AAG09695. 1 Publication
Sequence conflicti145 – 1451L → M in BAA91407. 1 Publication
Sequence conflicti180 – 1801F → I in BAA91611. 1 Publication
Sequence conflicti313 – 3131I → T in BAA92118. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000888 mRNA. Translation: BAA91407.1.
AK001185 mRNA. Translation: BAA91542.1.
AK001302 mRNA. Translation: BAA91611.1.
AK002167 mRNA. Translation: BAA92118.1.
AK023313 mRNA. Translation: BAB14521.1.
AK024478 mRNA. Translation: BAB15768.1. Different initiation.
AF183426 mRNA. Translation: AAG09695.1. Frameshift.
AL137002 Genomic DNA. Translation: CAI41391.1.
AL136221, AL137002 Genomic DNA. Translation: CAI13794.1.
AL137002, AL136221 Genomic DNA. Translation: CAI41378.1.
AL136221, AL137002 Genomic DNA. Translation: CAI13793.1.
AL137002, AL136221 Genomic DNA. Translation: CAI41377.1.
AL136221, AL137002 Genomic DNA. Translation: CAI13792.1.
AL137002, AL136221 Genomic DNA. Translation: CAI41379.1.
BC016614 mRNA. Translation: AAH16614.1.
BC031246 mRNA. Translation: AAH31246.1.
CCDSiCCDS58301.1. [Q5JVF3-2]
CCDS58302.1. [Q5JVF3-4]
CCDS9532.2. [Q5JVF3-1]
RefSeqiNP_001120674.1. NM_001127202.2. [Q5JVF3-1]
NP_001120675.1. NM_001127203.2. [Q5JVF3-1]
NP_001245141.1. NM_001258212.1. [Q5JVF3-4]
NP_001245142.1. NM_001258213.1. [Q5JVF3-2]
NP_060856.2. NM_018386.3. [Q5JVF3-1]
XP_005268381.1. XM_005268324.1. [Q5JVF3-2]
UniGeneiHs.508769.

Genome annotation databases

EnsembliENST00000246505; ENSP00000246505; ENSG00000126226. [Q5JVF3-4]
ENST00000337344; ENSP00000337405; ENSG00000126226. [Q5JVF3-1]
ENST00000375457; ENSP00000364606; ENSG00000126226. [Q5JVF3-2]
ENST00000375459; ENSP00000364608; ENSG00000126226. [Q5JVF3-2]
ENST00000375477; ENSP00000364626; ENSG00000126226. [Q5JVF3-1]
ENST00000375479; ENSP00000364628; ENSG00000126226. [Q5JVF3-1]
GeneIDi55795.
KEGGihsa:55795.
UCSCiuc001vtb.3. human. [Q5JVF3-1]
uc001vtg.3. human. [Q5JVF3-2]
uc021rmt.2. human. [Q5JVF3-4]

Polymorphism databases

DMDMi85681034.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000888 mRNA. Translation: BAA91407.1 .
AK001185 mRNA. Translation: BAA91542.1 .
AK001302 mRNA. Translation: BAA91611.1 .
AK002167 mRNA. Translation: BAA92118.1 .
AK023313 mRNA. Translation: BAB14521.1 .
AK024478 mRNA. Translation: BAB15768.1 . Different initiation.
AF183426 mRNA. Translation: AAG09695.1 . Frameshift.
AL137002 Genomic DNA. Translation: CAI41391.1 .
AL136221 , AL137002 Genomic DNA. Translation: CAI13794.1 .
AL137002 , AL136221 Genomic DNA. Translation: CAI41378.1 .
AL136221 , AL137002 Genomic DNA. Translation: CAI13793.1 .
AL137002 , AL136221 Genomic DNA. Translation: CAI41377.1 .
AL136221 , AL137002 Genomic DNA. Translation: CAI13792.1 .
AL137002 , AL136221 Genomic DNA. Translation: CAI41379.1 .
BC016614 mRNA. Translation: AAH16614.1 .
BC031246 mRNA. Translation: AAH31246.1 .
CCDSi CCDS58301.1. [Q5JVF3-2 ]
CCDS58302.1. [Q5JVF3-4 ]
CCDS9532.2. [Q5JVF3-1 ]
RefSeqi NP_001120674.1. NM_001127202.2. [Q5JVF3-1 ]
NP_001120675.1. NM_001127203.2. [Q5JVF3-1 ]
NP_001245141.1. NM_001258212.1. [Q5JVF3-4 ]
NP_001245142.1. NM_001258213.1. [Q5JVF3-2 ]
NP_060856.2. NM_018386.3. [Q5JVF3-1 ]
XP_005268381.1. XM_005268324.1. [Q5JVF3-2 ]
UniGenei Hs.508769.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3T5X X-ray 2.12 A 201-399 [» ]
ProteinModelPortali Q5JVF3.
SMRi Q5JVF3. Positions 168-399.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120908. 7 interactions.
DIPi DIP-50497N.
IntActi Q5JVF3. 5 interactions.

PTM databases

PhosphoSitei Q5JVF3.

Polymorphism databases

DMDMi 85681034.

Proteomic databases

MaxQBi Q5JVF3.
PaxDbi Q5JVF3.
PRIDEi Q5JVF3.

Protocols and materials databases

DNASUi 55795.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000246505 ; ENSP00000246505 ; ENSG00000126226 . [Q5JVF3-4 ]
ENST00000337344 ; ENSP00000337405 ; ENSG00000126226 . [Q5JVF3-1 ]
ENST00000375457 ; ENSP00000364606 ; ENSG00000126226 . [Q5JVF3-2 ]
ENST00000375459 ; ENSP00000364608 ; ENSG00000126226 . [Q5JVF3-2 ]
ENST00000375477 ; ENSP00000364626 ; ENSG00000126226 . [Q5JVF3-1 ]
ENST00000375479 ; ENSP00000364628 ; ENSG00000126226 . [Q5JVF3-1 ]
GeneIDi 55795.
KEGGi hsa:55795.
UCSCi uc001vtb.3. human. [Q5JVF3-1 ]
uc001vtg.3. human. [Q5JVF3-2 ]
uc021rmt.2. human. [Q5JVF3-4 ]

Organism-specific databases

CTDi 55795.
GeneCardsi GC13M113831.
H-InvDB HIX0130585.
HGNCi HGNC:25653. PCID2.
MIMi 613713. gene.
neXtProti NX_Q5JVF3.
PharmGKBi PA144596397.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5600.
HOVERGENi HBG055800.
OMAi PIMYAVA.
OrthoDBi EOG7TTQ7S.
PhylomeDBi Q5JVF3.
TreeFami TF106136.

Miscellaneous databases

GenomeRNAii 55795.
NextBioi 60919.
PROi Q5JVF3.
SOURCEi Search...

Gene expression databases

Bgeei Q5JVF3.
CleanExi HS_PCID2.
Genevestigatori Q5JVF3.

Family and domain databases

InterProi IPR013143. PAM.
IPR000717. PCI_dom.
[Graphical view ]
Pfami PF01399. PCI. 1 hit.
[Graphical view ]
SMARTi SM00753. PAM. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
    Tissue: Embryo, Ovary, Placenta, Spleen and Teratocarcinoma.
  2. "A novel gene expressed in human hypothalamus."
    Peng Y., Li N., Jia J., Xu S., Han Z., Fu G., Chen Z.
    Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hypothalamus.
  3. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Eye and Testis.
  5. Bienvenut W.V.
    Submitted (JAN-2010) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 2-20; 83-93; 117-128 AND 250-259, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Ovarian carcinoma.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPCID2_HUMAN
AccessioniPrimary (citable) accession number: Q5JVF3
Secondary accession number(s): A6NK09
, Q3ZCX1, Q5TC57, Q5TC58, Q9H7K1, Q9HBZ7, Q9NUK6, Q9NVY1, Q9NW44, Q9NWH3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: September 3, 2014
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi