Reviewed,
UniProtKB/Swiss-Prot Q5JVF3 (PCID2_HUMAN)
Last modified
March 2, 2010.
Version 53.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Binary interactions · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: PCI domain-containing protein 2 Alternative name(s): CSN12-like protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 399 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Sequence similarities | Belongs to the CSN12 family. Contains 1 PCI domain. |
| Sequence caution | The sequence AAG09695.1 differs from that shown. Reason: Frameshift at position 48. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing |
| Gene Ontology (GO) | |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5JVF3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5JVF3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-12: MAHITINQYLQQ → MRLTDVVQQL | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q5JVF3-3) The sequence of this isoform differs from the canonical sequence as follows: 92-114: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q5JVF3-4) The sequence of this isoform differs from the canonical sequence as follows: 89-89: Q → QYPLSFMAAVPHRTHAVDYLGLETRKHWASCSFLQLERNDSVLEQKLVSALSLGT | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||
| Chain | 2 – 399 | 398 | PCI domain-containing protein 2 | PRO_0000121029 | |||||
Regions | |||||||||
| Domain | 277 – 388 | 112 | PCI | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine | ||||||
| Modified residue | 232 | 1 | Phosphotyrosine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 12 | 12 | MAHIT…QYLQQ → MRLTDVVQQL in isoform 2. | VSP_016843 | |||||
| Alternative sequence | 89 | 1 | Q → QYPLSFMAAVPHRTHAVDYL GLETRKHWASCSFLQLERND SVLEQKLVSALSLGT in isoform 4. | VSP_016844 | |||||
| Alternative sequence | 92 – 114 | 23 | Missing in isoform 3. | VSP_016845 | |||||
Experimental info | |||||||||
| Sequence conflict | 74 | 1 | N → D in AAH31246. Ref.4 | ||||||
| Sequence conflict | 87 | 1 | I → L in BAA91407. Ref.1 | ||||||
| Sequence conflict | 106 | 1 | P → L in AAG09695. Ref.2 | ||||||
| Sequence conflict | 129 | 1 | K → E in AAG09695. Ref.2 | ||||||
| Sequence conflict | 145 | 1 | L → M in BAA91407. Ref.1 | ||||||
| Sequence conflict | 180 | 1 | F → I in BAA91611. Ref.1 | ||||||
| Sequence conflict | 313 | 1 | I → T in BAA92118. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4). Tissue: Embryo, Ovary, Placenta, Spleen and Teratocarcinoma. |
| [2] | "A novel gene expressed in human hypothalamus." Peng Y., Li N., Jia J., Xu S., Han Z., Fu G., Chen Z. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hypothalamus. |
| [3] | "The DNA sequence and analysis of human chromosome 13." Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. Ross M.T.Nature 428:522-528(2004) [PubMed: 15057823] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Eye and Testis. |
| [5] | Bienvenut W.V. Submitted (JAN-2010) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-20; 83-93; 117-128 AND 250-259, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: Ovarian carcinoma. |
| [6] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-232, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK000888 mRNA. Translation: BAA91407.1. AK001185 mRNA. Translation: BAA91542.1. AK001302 mRNA. Translation: BAA91611.1. AK002167 mRNA. Translation: BAA92118.1. AK023313 mRNA. Translation: BAB14521.1. AK024478 mRNA. Translation: BAB15768.1. Different initiation. AF183426 mRNA. Translation: AAG09695.1. Frameshift. AL137002 Genomic DNA. Translation: CAI41391.1. AL136221, AL137002 Genomic DNA. Translation: CAI13794.1. AL137002, AL136221 Genomic DNA. Translation: CAI41378.1. AL136221, AL137002 Genomic DNA. Translation: CAI13793.1. AL137002, AL136221 Genomic DNA. Translation: CAI41377.1. AL136221, AL137002 Genomic DNA. Translation: CAI13792.1. AL137002, AL136221 Genomic DNA. Translation: CAI41379.1. BC016614 mRNA. Translation: AAH16614.1. BC031246 mRNA. Translation: AAH31246.1. |
| IPI | IPI00072541. IPI00100313. IPI00395420. IPI00478550. |
| RefSeq | NP_001120674.1. NP_001120675.1. NP_060856.2. |
| UniGene | Hs.508769 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5JVF3. 3 interactions. |
| STRING | Q5JVF3. |
PTM databases | |
| PhosphoSite | Q5JVF3. |
Proteomic databases | |
| PRIDE | Q5JVF3. |
Genome annotation databases | |
| Ensembl | ENST00000337344; ENSP00000337405; ENSG00000126226; Homo sapiens. [Genome view] ENST00000375477; ENSP00000364626; ENSG00000126226; Homo sapiens. [Genome view] ENST00000375479; ENSP00000364628; ENSG00000126226; Homo sapiens. [Genome view] |
| GeneID | 55795. |
| KEGG | hsa:55795. |
| UCSC | uc001vtc.1. human. |
Organism-specific databases | |
| CTD | 55795. |
| GeneCards | GC13M112881. |
| H-InvDB | HIX0011473. |
| HGNC | HGNC:25653. PCID2. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG06804. |
| HOVERGEN | HBG055800. |
| OMA | YFRINKL. |
| OrthoDB | EOG99S8S0. |
| PhylomeDB | Q5JVF3. |
Gene expression databases | |
| ArrayExpress | Q5JVF3. |
| Bgee | Q5JVF3. |
| CleanEx | HS_PCID2. |
| Genevestigator | Q5JVF3. |
| GermOnline | ENSG00000126226. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR013143. PAM. IPR000717. PCI_dom. [Graphical view] |
| Pfam | PF01399. PCI. 1 hit. [Graphical view] |
| SMART | SM00753. PAM. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 60919. |
Entry information
| Entry name | PCID2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5JVF3 Secondary accession number(s): A6NK09 Q9NWH3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with


