Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5JVF3 (PCID2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 92. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
PCI domain-containing protein 2
Alternative name(s):
CSN12-like protein
Gene names
Name:PCID2
ORF Names:HT004
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length399 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Required for B-cell survival through the regulation of the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation By similarity.

Sequence similarities

Belongs to the CSN12 family.

Contains 1 PCI domain.

Sequence caution

The sequence AAG09695.1 differs from that shown. Reason: Frameshift at position 48.

The sequence BAB15768.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5JVF3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5JVF3-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MAHITINQYLQQ → MRLTDVVQQL
Note: No experimental confirmation available.
Isoform 3 (identifier: Q5JVF3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     92-114: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q5JVF3-4)

The sequence of this isoform differs from the canonical sequence as follows:
     89-89: Q → QYPLSFMAAVPHRTHAVDYLGLETRKHWASCSFLQLERNDSVLEQKLVSALSLGT
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed Ref.5
Chain2 – 399398PCI domain-containing protein 2
PRO_0000121029

Regions

Domain277 – 388112PCI

Amino acid modifications

Modified residue21N-acetylalanine Ref.5

Natural variations

Alternative sequence1 – 1212MAHIT…QYLQQ → MRLTDVVQQL in isoform 2.
VSP_016843
Alternative sequence891Q → QYPLSFMAAVPHRTHAVDYL GLETRKHWASCSFLQLERND SVLEQKLVSALSLGT in isoform 4.
VSP_016844
Alternative sequence92 – 11423Missing in isoform 3.
VSP_016845

Experimental info

Sequence conflict741N → D in AAH31246. Ref.4
Sequence conflict871I → L in BAA91407. Ref.1
Sequence conflict1061P → L in AAG09695. Ref.2
Sequence conflict1291K → E in AAG09695. Ref.2
Sequence conflict1451L → M in BAA91407. Ref.1
Sequence conflict1801F → I in BAA91611. Ref.1
Sequence conflict3131I → T in BAA92118. Ref.1

Secondary structure

............................... 399
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 10, 2006. Version 2.
Checksum: 8D23273361F00E18

FASTA39946,030
        10         20         30         40         50         60 
MAHITINQYL QQVYEAIDSR DGASCAELVS FKHPHVANPR LQMASPEEKC QQVLEPPYDE 

        70         80         90        100        110        120 
MFAAHLRCTY AVGNHDFIEA YKCQTVIVQS FLRAFQAHKE ENWALPVMYA VALDLRVFAN 

       130        140        150        160        170        180 
NADQQLVKKG KSKVGDMLEK AAELLMSCFR VCASDTRAGI EDSKKWGMLF LVNQLFKIYF 

       190        200        210        220        230        240 
KINKLHLCKP LIRAIDSSNL KDDYSTAQRV TYKYYVGRKA MFDSDFKQAE EYLSFAFEHC 

       250        260        270        280        290        300 
HRSSQKNKRM ILIYLLPVKM LLGHMPTVEL LKKYHLMQFA EVTRAVSEGN LLLLHEALAK 

       310        320        330        340        350        360 
HEAFFIRCGI FLILEKLKII TYRNLFKKVY LLLKTHQLSL DAFLVALKFM QVEDVDIDEV 

       370        380        390 
QCILANLIYM GHVKGYISHQ HQKLVVSKQN PFPPLSTVC 

« Hide

Isoform 2 [UniParc].

Checksum: 785FD46B5D72AF70
Show »

FASTA39745,773
Isoform 3 [UniParc].

Checksum: 039E8F8B8192F3C1
Show »

FASTA37643,375
Isoform 4 [UniParc].

Checksum: 57BB6C3A1E85A059
Show »

FASTA45352,100

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
Tissue: Embryo, Ovary, Placenta, Spleen and Teratocarcinoma.
[2]"A novel gene expressed in human hypothalamus."
Peng Y., Li N., Jia J., Xu S., Han Z., Fu G., Chen Z.
Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Hypothalamus.
[3]"The DNA sequence and analysis of human chromosome 13."
Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Eye and Testis.
[5]Bienvenut W.V.
Submitted (JAN-2010) to UniProtKB
Cited for: PROTEIN SEQUENCE OF 2-20; 83-93; 117-128 AND 250-259, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY.
Tissue: Ovarian carcinoma.
[6]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK000888 mRNA. Translation: BAA91407.1.
AK001185 mRNA. Translation: BAA91542.1.
AK001302 mRNA. Translation: BAA91611.1.
AK002167 mRNA. Translation: BAA92118.1.
AK023313 mRNA. Translation: BAB14521.1.
AK024478 mRNA. Translation: BAB15768.1. Different initiation.
AF183426 mRNA. Translation: AAG09695.1. Frameshift.
AL137002 Genomic DNA. Translation: CAI41391.1.
AL136221, AL137002 Genomic DNA. Translation: CAI13794.1.
AL137002, AL136221 Genomic DNA. Translation: CAI41378.1.
AL136221, AL137002 Genomic DNA. Translation: CAI13793.1.
AL137002, AL136221 Genomic DNA. Translation: CAI41377.1.
AL136221, AL137002 Genomic DNA. Translation: CAI13792.1.
AL137002, AL136221 Genomic DNA. Translation: CAI41379.1.
BC016614 mRNA. Translation: AAH16614.1.
BC031246 mRNA. Translation: AAH31246.1.
CCDSCCDS58301.1. [Q5JVF3-2]
CCDS58302.1. [Q5JVF3-4]
CCDS9532.2. [Q5JVF3-1]
RefSeqNP_001120674.1. NM_001127202.2. [Q5JVF3-1]
NP_001120675.1. NM_001127203.2. [Q5JVF3-1]
NP_001245141.1. NM_001258212.1. [Q5JVF3-4]
NP_001245142.1. NM_001258213.1. [Q5JVF3-2]
NP_060856.2. NM_018386.3. [Q5JVF3-1]
XP_005268381.1. XM_005268324.1. [Q5JVF3-2]
UniGeneHs.508769.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3T5XX-ray2.12A201-399[»]
ProteinModelPortalQ5JVF3.
SMRQ5JVF3. Positions 168-399.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120908. 6 interactions.
DIPDIP-50497N.
IntActQ5JVF3. 5 interactions.

PTM databases

PhosphoSiteQ5JVF3.

Polymorphism databases

DMDM85681034.

Proteomic databases

MaxQBQ5JVF3.
PaxDbQ5JVF3.
PRIDEQ5JVF3.

Protocols and materials databases

DNASU55795.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000246505; ENSP00000246505; ENSG00000126226. [Q5JVF3-4]
ENST00000337344; ENSP00000337405; ENSG00000126226. [Q5JVF3-1]
ENST00000375457; ENSP00000364606; ENSG00000126226. [Q5JVF3-2]
ENST00000375459; ENSP00000364608; ENSG00000126226. [Q5JVF3-2]
ENST00000375477; ENSP00000364626; ENSG00000126226. [Q5JVF3-1]
ENST00000375479; ENSP00000364628; ENSG00000126226. [Q5JVF3-1]
GeneID55795.
KEGGhsa:55795.
UCSCuc001vtb.3. human. [Q5JVF3-1]
uc001vtg.3. human. [Q5JVF3-2]
uc021rmt.2. human. [Q5JVF3-4]

Organism-specific databases

CTD55795.
GeneCardsGC13M113831.
H-InvDBHIX0130585.
HGNCHGNC:25653. PCID2.
MIM613713. gene.
neXtProtNX_Q5JVF3.
PharmGKBPA144596397.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5600.
HOVERGENHBG055800.
OMAPIMYAVA.
OrthoDBEOG7TTQ7S.
PhylomeDBQ5JVF3.
TreeFamTF106136.

Gene expression databases

BgeeQ5JVF3.
CleanExHS_PCID2.
GenevestigatorQ5JVF3.

Family and domain databases

InterProIPR013143. PAM.
IPR000717. PCI_dom.
[Graphical view]
PfamPF01399. PCI. 1 hit.
[Graphical view]
SMARTSM00753. PAM. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi55795.
NextBio60919.
PROQ5JVF3.
SOURCESearch...

Entry information

Entry namePCID2_HUMAN
AccessionPrimary (citable) accession number: Q5JVF3
Secondary accession number(s): A6NK09 expand/collapse secondary AC list , Q3ZCX1, Q5TC57, Q5TC58, Q9H7K1, Q9HBZ7, Q9NUK6, Q9NVY1, Q9NW44, Q9NWH3
Entry history
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: July 9, 2014
This is version 92 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 13

Human chromosome 13: entries, gene names and cross-references to MIM