Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Proteasome assembly chaperone 4

Gene

PSMG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Chaperone protein which promotes assembly of the 20S proteasome.

GO - Biological processi

Keywordsi

Molecular functionChaperone

Names & Taxonomyi

Protein namesi
Recommended name:
Proteasome assembly chaperone 4
Short name:
PAC-4
Short name:
hPAC4
Gene namesi
Name:PSMG4
Synonyms:C6orf86, PAC4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000180822.11
HGNCiHGNC:21108 PSMG4
MIMi617550 gene
neXtProtiNX_Q5JS54

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000180822
PharmGKBiPA162400256

Polymorphism and mutation databases

BioMutaiPSMG4
DMDMi190360085

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003413971 – 123Proteasome assembly chaperone 4Add BLAST123

Proteomic databases

EPDiQ5JS54
MaxQBiQ5JS54
PeptideAtlasiQ5JS54
PRIDEiQ5JS54
TopDownProteomicsiQ5JS54-1 [Q5JS54-1]

Expressioni

Gene expression databases

BgeeiENSG00000180822
CleanExiHS_PSMG4
ExpressionAtlasiQ5JS54 baseline and differential
GenevisibleiQ5JS54 HS

Organism-specific databases

HPAiHPA067652

Interactioni

Subunit structurei

Interacts with PSMG3. Associates with alpha subunits of the 20S proteasome (By similarity).By similarity

Protein-protein interaction databases

BioGridi133110, 33 interactors
CORUMiQ5JS54

Structurei

Secondary structure

1123
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi13 – 21Combined sources9
Beta strandi24 – 32Combined sources9
Beta strandi34 – 42Combined sources9
Beta strandi50 – 54Combined sources5
Beta strandi57 – 61Combined sources5
Beta strandi63 – 66Combined sources4
Helixi75 – 87Combined sources13
Beta strandi88 – 95Combined sources8
Helixi102 – 118Combined sources17
Helixi120 – 122Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5WTQX-ray1.90A/B/C/D1-123[»]
ProteinModelPortaliQ5JS54
SMRiQ5JS54
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the PSMG4 family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000011804
HOGENOMiHOG000060342
HOVERGENiHBG089938
InParanoidiQ5JS54
KOiK11878
OMAiVHFHVMK
OrthoDBiEOG091G18UD
PhylomeDBiQ5JS54
TreeFamiTF353302

Family and domain databases

InterProiView protein in InterPro
IPR032157 PAC4
PfamiView protein in Pfam
PF16093 PAC4, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5JS54-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGLVVAAGG DVSLHNFSAR LWEQLVHFHV MRLTDSLFLW VGATPHLRNL
60 70 80 90 100
AVAMCSRYDS IPVSTSLLGD TSDTTSTGLA QRLARKTNKQ VFVSYNLQNT
110 120
DSNFALLVEN RIKEEMEAFP EKF
Length:123
Mass (Da):13,775
Last modified:June 10, 2008 - v2
Checksum:i44F98C0CC00B937F
GO
Isoform 2 (identifier: Q5JS54-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-83: L → LGLGGKTGLACECGVEWGLSKGHEAECSTLPTPQHTSCGP

Note: No experimental confirmation available.
Show »
Length:162
Mass (Da):17,656
Checksum:i74DDE9E665AD0E2C
GO
Isoform 3 (identifier: Q5JS54-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     84-123: ARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF → GMYPQLALHGQPGGAHSLMEP

Note: No experimental confirmation available.
Show »
Length:104
Mass (Da):11,216
Checksum:i1CFBFF2D577224DE
GO

Sequence cautioni

The sequence CAI40954 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI40955 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI40957 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti47L → Q in CD173424 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04663583L → LGLGGKTGLACECGVEWGLS KGHEAECSTLPTPQHTSCGP in isoform 2. Curated1
Alternative sequenceiVSP_04663684 – 123ARKTN…FPEKF → GMYPQLALHGQPGGAHSLME P in isoform 3. CuratedAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL445309 Genomic DNA Translation: CAI40954.1 Sequence problems.
AL445309 Genomic DNA Translation: CAI40955.1 Sequence problems.
AL445309 Genomic DNA Translation: CAI40957.1 Different initiation.
CH471087 Genomic DNA Translation: EAW55130.1
CD173424 mRNA No translation available.
CCDSiCCDS47360.1 [Q5JS54-2]
CCDS47361.1 [Q5JS54-1]
CCDS47362.1 [Q5JS54-3]
RefSeqiNP_001122063.1, NM_001128591.1 [Q5JS54-1]
NP_001122064.1, NM_001128592.1 [Q5JS54-2]
NP_001129222.1, NM_001135750.1 [Q5JS54-3]
UniGeneiHs.207069
Hs.731726

Genome annotation databases

EnsembliENST00000419065; ENSP00000392353; ENSG00000180822 [Q5JS54-2]
ENST00000438998; ENSP00000413353; ENSG00000180822 [Q5JS54-1]
ENST00000473000; ENSP00000418241; ENSG00000180822 [Q5JS54-3]
GeneIDi389362
KEGGihsa:389362
UCSCiuc003mvl.2 human [Q5JS54-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPSMG4_HUMAN
AccessioniPrimary (citable) accession number: Q5JS54
Secondary accession number(s): C9J2F8
, F8WBZ2, Q5JS53, Q5JS56
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: February 28, 2018
This is version 85 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health