Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Proteasome assembly chaperone 4

Gene

PSMG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Chaperone protein which promotes assembly of the 20S proteasome.

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Names & Taxonomyi

Protein namesi
Recommended name:
Proteasome assembly chaperone 4
Short name:
PAC-4
Short name:
hPAC4
Gene namesi
Name:PSMG4
Synonyms:C6orf86, PAC4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21108. PSMG4.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162400256.

Polymorphism and mutation databases

BioMutaiPSMG4.
DMDMi190360085.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 123123Proteasome assembly chaperone 4PRO_0000341397Add
BLAST

Proteomic databases

EPDiQ5JS54.
MaxQBiQ5JS54.
PeptideAtlasiQ5JS54.
PRIDEiQ5JS54.
TopDownProteomicsiQ5JS54-1. [Q5JS54-1]

Expressioni

Gene expression databases

BgeeiQ5JS54.
CleanExiHS_PSMG4.
ExpressionAtlasiQ5JS54. baseline and differential.
GenevisibleiQ5JS54. HS.

Interactioni

Subunit structurei

Interacts with PSMG3. Associates with alpha subunits of the 20S proteasome (By similarity).By similarity

Protein-protein interaction databases

BioGridi133110. 24 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ5JS54.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the PSMG4 family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000011804.
HOGENOMiHOG000060342.
HOVERGENiHBG089938.
InParanoidiQ5JS54.
KOiK11878.
OMAiSCGPARK.
PhylomeDBiQ5JS54.
TreeFamiTF353302.

Family and domain databases

InterProiIPR032157. PAC4.
[Graphical view]
PfamiPF16093. PAC4. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5JS54-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGLVVAAGG DVSLHNFSAR LWEQLVHFHV MRLTDSLFLW VGATPHLRNL
60 70 80 90 100
AVAMCSRYDS IPVSTSLLGD TSDTTSTGLA QRLARKTNKQ VFVSYNLQNT
110 120
DSNFALLVEN RIKEEMEAFP EKF
Length:123
Mass (Da):13,775
Last modified:June 10, 2008 - v2
Checksum:i44F98C0CC00B937F
GO
Isoform 2 (identifier: Q5JS54-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-83: L → LGLGGKTGLACECGVEWGLSKGHEAECSTLPTPQHTSCGP

Note: No experimental confirmation available.
Show »
Length:162
Mass (Da):17,656
Checksum:i74DDE9E665AD0E2C
GO
Isoform 3 (identifier: Q5JS54-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     84-123: ARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF → GMYPQLALHGQPGGAHSLMEP

Note: No experimental confirmation available.
Show »
Length:104
Mass (Da):11,216
Checksum:i1CFBFF2D577224DE
GO

Sequence cautioni

The sequence CAI40954.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI40955.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI40957.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti47 – 471L → Q in CD173424 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei83 – 831L → LGLGGKTGLACECGVEWGLS KGHEAECSTLPTPQHTSCGP in isoform 2. CuratedVSP_046635
Alternative sequencei84 – 12340ARKTN…FPEKF → GMYPQLALHGQPGGAHSLME P in isoform 3. CuratedVSP_046636Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL445309 Genomic DNA. Translation: CAI40954.1. Sequence problems.
AL445309 Genomic DNA. Translation: CAI40955.1. Sequence problems.
AL445309 Genomic DNA. Translation: CAI40957.1. Different initiation.
CH471087 Genomic DNA. Translation: EAW55130.1.
CD173424 mRNA. No translation available.
CCDSiCCDS47360.1. [Q5JS54-2]
CCDS47361.1. [Q5JS54-1]
CCDS47362.1. [Q5JS54-3]
RefSeqiNP_001122063.1. NM_001128591.1. [Q5JS54-1]
NP_001122064.1. NM_001128592.1. [Q5JS54-2]
NP_001129222.1. NM_001135750.1. [Q5JS54-3]
UniGeneiHs.207069.
Hs.731726.

Genome annotation databases

EnsembliENST00000419065; ENSP00000392353; ENSG00000180822. [Q5JS54-2]
ENST00000438998; ENSP00000413353; ENSG00000180822. [Q5JS54-1]
ENST00000473000; ENSP00000418241; ENSG00000180822. [Q5JS54-3]
GeneIDi389362.
KEGGihsa:389362.
UCSCiuc003mvl.2. human. [Q5JS54-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL445309 Genomic DNA. Translation: CAI40954.1. Sequence problems.
AL445309 Genomic DNA. Translation: CAI40955.1. Sequence problems.
AL445309 Genomic DNA. Translation: CAI40957.1. Different initiation.
CH471087 Genomic DNA. Translation: EAW55130.1.
CD173424 mRNA. No translation available.
CCDSiCCDS47360.1. [Q5JS54-2]
CCDS47361.1. [Q5JS54-1]
CCDS47362.1. [Q5JS54-3]
RefSeqiNP_001122063.1. NM_001128591.1. [Q5JS54-1]
NP_001122064.1. NM_001128592.1. [Q5JS54-2]
NP_001129222.1. NM_001135750.1. [Q5JS54-3]
UniGeneiHs.207069.
Hs.731726.

3D structure databases

ProteinModelPortaliQ5JS54.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi133110. 24 interactions.

Polymorphism and mutation databases

BioMutaiPSMG4.
DMDMi190360085.

Proteomic databases

EPDiQ5JS54.
MaxQBiQ5JS54.
PeptideAtlasiQ5JS54.
PRIDEiQ5JS54.
TopDownProteomicsiQ5JS54-1. [Q5JS54-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000419065; ENSP00000392353; ENSG00000180822. [Q5JS54-2]
ENST00000438998; ENSP00000413353; ENSG00000180822. [Q5JS54-1]
ENST00000473000; ENSP00000418241; ENSG00000180822. [Q5JS54-3]
GeneIDi389362.
KEGGihsa:389362.
UCSCiuc003mvl.2. human. [Q5JS54-1]

Organism-specific databases

CTDi389362.
GeneCardsiPSMG4.
HGNCiHGNC:21108. PSMG4.
neXtProtiNX_Q5JS54.
PharmGKBiPA162400256.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000011804.
HOGENOMiHOG000060342.
HOVERGENiHBG089938.
InParanoidiQ5JS54.
KOiK11878.
OMAiSCGPARK.
PhylomeDBiQ5JS54.
TreeFamiTF353302.

Miscellaneous databases

GenomeRNAii389362.
PROiQ5JS54.

Gene expression databases

BgeeiQ5JS54.
CleanExiHS_PSMG4.
ExpressionAtlasiQ5JS54. baseline and differential.
GenevisibleiQ5JS54. HS.

Family and domain databases

InterProiIPR032157. PAC4.
[Graphical view]
PfamiPF16093. PAC4. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Embryonic stem cell.
  4. "20S proteasome assembly is orchestrated by two distinct pairs of chaperones in yeast and in mammals."
    Le Tallec B., Barrault M.-B., Courbeyrette R., Guerois R., Marsolier-Kergoat M.-C., Peyroche A.
    Mol. Cell 27:660-674(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.

Entry informationi

Entry nameiPSMG4_HUMAN
AccessioniPrimary (citable) accession number: Q5JS54
Secondary accession number(s): C9J2F8
, F8WBZ2, Q5JS53, Q5JS56
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: July 6, 2016
This is version 75 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.