Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5JS13

- RGPS1_HUMAN

UniProt

Q5JS13 - RGPS1_HUMAN

Protein

Ras-specific guanine nucleotide-releasing factor RalGPS1

Gene

RALGPS1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 69 (01 Oct 2014)
      Sequence version 1 (05 Feb 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization By similarity. Guanine nucleotide exchange factor for.By similarity2 Publications

    GO - Molecular functioni

    1. guanyl-nucleotide exchange factor activity Source: UniProtKB
    2. Ral guanyl-nucleotide exchange factor activity Source: FlyBase

    GO - Biological processi

    1. intracellular signal transduction Source: UniProtKB
    2. positive regulation of GTPase activity Source: GOC
    3. positive regulation of Ral GTPase activity Source: GOC
    4. regulation of Ral protein signal transduction Source: FlyBase
    5. small GTPase mediated signal transduction Source: InterPro

    Keywords - Molecular functioni

    Guanine-nucleotide releasing factor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ras-specific guanine nucleotide-releasing factor RalGPS1
    Alternative name(s):
    Ral GEF with PH domain and SH3-binding motif 1
    Ral guanine nucleotide exchange factor 2
    Short name:
    RalGEF 2
    RalA exchange factor RalGPS1
    Gene namesi
    Name:RALGPS1
    Synonyms:KIAA0351, RALGEF2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:16851. RALGPS1.

    Subcellular locationi

    Cytoplasm 1 Publication. Cell membrane 1 Publication
    Note: Associates with membranes through the PH domain.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi148 – 1481L → A: Loss of activity. 1 Publication

    Organism-specific databases

    PharmGKBiPA134907502.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 557557Ras-specific guanine nucleotide-releasing factor RalGPS1PRO_0000333192Add
    BLAST

    Proteomic databases

    MaxQBiQ5JS13.
    PaxDbiQ5JS13.
    PRIDEiQ5JS13.

    PTM databases

    PhosphoSiteiQ5JS13.

    Expressioni

    Tissue specificityi

    Widely expressed (at protein level). Isoform 2 is expressed in brain, colon, kidney, pancreas, prostate, skeletal muscle, small intestine, testis, thymus and uterus. Isoform 1 is expressed at high levels in heart and testis and at lower levels in brain, pancreas, skeletal muscle, small intestine and thymus.2 Publications

    Gene expression databases

    ArrayExpressiQ5JS13.
    BgeeiQ5JS13.
    CleanExiHS_RALGPS1.
    GenevestigatoriQ5JS13.

    Interactioni

    Subunit structurei

    Interacts with the SH3 domains of GRB2, NCK1, PLCG1 and SRC.1 Publication

    Protein-protein interaction databases

    BioGridi115007. 6 interactions.
    IntActiQ5JS13. 2 interactions.
    MINTiMINT-7968995.

    Structurei

    Secondary structure

    1
    557
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi46 – 483
    Helixi51 – 6717
    Helixi71 – 766
    Helixi84 – 874
    Helixi89 – 11022
    Helixi115 – 13420
    Helixi138 – 14811
    Helixi151 – 1544
    Helixi157 – 1615
    Helixi165 – 17713
    Helixi181 – 19212
    Turni193 – 1964
    Helixi203 – 21614
    Beta strandi219 – 2213
    Helixi223 – 24523
    Helixi256 – 2638
    Helixi269 – 2713
    Helixi272 – 28615

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3QXLX-ray2.24A/B23-289[»]
    ProteinModelPortaliQ5JS13.
    SMRiQ5JS13. Positions 44-288, 432-547.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini50 – 289240Ras-GEFPROSITE-ProRule annotationAdd
    BLAST
    Domaini431 – 543113PHPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni433 – 557125Required for stimulation of nucleotide exchange by RALAAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi330 – 3334PXXP

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi21 – 266Poly-Ser

    Domaini

    The PH domain mediates binding to membranes. It is required for efficient GEF activity.

    Sequence similaritiesi

    Contains 1 PH domain.PROSITE-ProRule annotation
    Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG275669.
    HOVERGENiHBG059258.
    InParanoidiQ5JS13.
    OMAiAPNIVAF.
    OrthoDBiEOG70KGP7.
    PhylomeDBiQ5JS13.
    TreeFamiTF352150.

    Family and domain databases

    Gene3Di1.10.840.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProiIPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR023578. Ras_GEF_dom.
    IPR001895. RasGRF_CDC25.
    [Graphical view]
    PfamiPF00169. PH. 1 hit.
    PF00617. RasGEF. 1 hit.
    [Graphical view]
    SMARTiSM00233. PH. 1 hit.
    SM00147. RasGEF. 1 hit.
    [Graphical view]
    SUPFAMiSSF48366. SSF48366. 1 hit.
    PROSITEiPS50003. PH_DOMAIN. 1 hit.
    PS50009. RASGEF_CAT. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5JS13-1) [UniParc]FASTAAdd to Basket

    Also known as: RALGPS1B

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MYKRNGLMAS VLVTSATPQG SSSSDSLEGQ SCDYASKSYD AVVFDVLKVT    50
    PEEFASQITL MDIPVFKAIQ PEELASCGWS KKEKHSLAPN VVAFTRRFNQ 100
    VSFWVVREIL TAQTLKIRAE ILSHFVKIAK KLLELNNLHS LMSVVSALQS 150
    APIFRLTKTW ALLNRKDKTT FEKLDYLMSK EDNYKRTREY IRSLKMVPSI 200
    PYLGIYLLDL IYIDSAYPAS GSIMENEQRS NQMNNILRII ADLQVSCSYD 250
    HLTTLPHVQK YLKSVRYIEE LQKFVEDDNY KLSLRIEPGS SSPRLVSSKE 300
    DLAGPSAGSG SARFSRRPTC PDTSVAGSLP TPPVPRHRKS HSLGNNMMCQ 350
    LSVVESKSAT FPSEKARHLL DDSVLESRSP RRGLALTSSS AVTNGLSLGS 400
    SESSEFSEEM SSGLESPTGP CICSLGNSAA VPTMEGPLRR KTLLKEGRKP 450
    ALSSWTRYWV ILSGSTLLYY GAKSLRGTDR KHYKSTPGKK VSIVGWMVQL 500
    PDDPEHPDIF QLNNPDKGNV YKFQTGSRFH AILWHKHLDD ACKSNRPQVP 550
    ANLMSFE 557
    Length:557
    Mass (Da):62,133
    Last modified:February 5, 2008 - v1
    Checksum:i0C93A55468ED95ED
    GO
    Isoform 2 (identifier: Q5JS13-2) [UniParc]FASTAAdd to Basket

    Also known as: RALGPS1A

    The sequence of this isoform differs from the canonical sequence as follows:
         347-415: MMCQLSVVES...FSEEMSSGLE → RGRLYATLGPNWRVPVRNSPRTRSCVY
         483-490: Missing.
         549-557: VPANLMSFE → EAGAAPGPTGTDSHEVDHLEGGAGKEAGPCA

    Note: No experimental confirmation available.

    Show »
    Length:529
    Mass (Da):58,975
    Checksum:i49CFB803DABF6BAA
    GO
    Isoform 3 (identifier: Q5JS13-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         304-384: GPSAGSGSAR...LESRSPRRGL → VSHLSSLSHQ...TLGSRSRRIT
         385-557: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:384
    Mass (Da):43,154
    Checksum:i2B0F6988D850036E
    GO
    Isoform 4 (identifier: Q5JS13-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         304-305: GP → AM
         306-557: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:305
    Mass (Da):34,728
    Checksum:iA23253E8A5E97706
    GO
    Isoform 5 (identifier: Q5JS13-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         205-213: IYLLDLIYI → RSLNWLIFF
         214-557: Missing.

    Note: Gene prediction based on EST data. No experimental confirmation available.

    Show »
    Length:213
    Mass (Da):24,325
    Checksum:i6BE4541C45159E89
    GO
    Isoform 6 (identifier: Q5JS13-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         73-108: ELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVRE → KGWPARMEDSLQKSTVSSRPHDTLQFRKTLPVGPGT
         109-557: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:108
    Mass (Da):11,772
    Checksum:i96CA60064D585BB5
    GO
    Isoform 7 (identifier: Q5JS13-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         347-415: MMCQLSVVES...FSEEMSSGLE → RGRLYATLGPNWRVPVRNSPRTRSCVY
         549-557: VPANLMSFE → EAGAAPGPTGTDSHEVDHLEGGAGKEAGPCA

    Note: No experimental confirmation available.

    Show »
    Length:537
    Mass (Da):59,865
    Checksum:i3CCD9778267F43FA
    GO

    Sequence cautioni

    The sequence AAH19329.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAA20808.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti86 – 861S → T in AAH32372. (PubMed:15489334)Curated
    Sequence conflicti189 – 1891E → G in BAG61198. (PubMed:14702039)Curated
    Sequence conflicti251 – 2511H → R in BAG61198. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti290 – 2901S → N.
    Corresponds to variant rs55918931 [ dbSNP | Ensembl ].
    VAR_061785

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei73 – 10836ELASC…WVVRE → KGWPARMEDSLQKSTVSSRP HDTLQFRKTLPVGPGT in isoform 6. 1 PublicationVSP_033471Add
    BLAST
    Alternative sequencei109 – 557449Missing in isoform 6. 1 PublicationVSP_033472Add
    BLAST
    Alternative sequencei205 – 2139IYLLDLIYI → RSLNWLIFF in isoform 5. CuratedVSP_033473
    Alternative sequencei214 – 557344Missing in isoform 5. CuratedVSP_033474Add
    BLAST
    Alternative sequencei304 – 38481GPSAG…PRRGL → VSHLSSLSHQGQAEEARLKP TSGQHPAWMWPSSSRVPAAP PASAAPRSPWPRNLRNDQGQ PGAVALTCNPSTLGSRSRRI T in isoform 3. 1 PublicationVSP_033475Add
    BLAST
    Alternative sequencei304 – 3052GP → AM in isoform 4. 1 PublicationVSP_033476
    Alternative sequencei306 – 557252Missing in isoform 4. 1 PublicationVSP_033477Add
    BLAST
    Alternative sequencei347 – 41569MMCQL…SSGLE → RGRLYATLGPNWRVPVRNSP RTRSCVY in isoform 2 and isoform 7. 2 PublicationsVSP_033478Add
    BLAST
    Alternative sequencei385 – 557173Missing in isoform 3. 1 PublicationVSP_033479Add
    BLAST
    Alternative sequencei483 – 4908Missing in isoform 2. 1 PublicationVSP_033480
    Alternative sequencei549 – 5579VPANLMSFE → EAGAAPGPTGTDSHEVDHLE GGAGKEAGPCA in isoform 2 and isoform 7. 2 PublicationsVSP_033481

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF221098 mRNA. Translation: AAF65253.1.
    AB002349 mRNA. Translation: BAA20808.2. Different initiation.
    AK299149 mRNA. Translation: BAG61198.1.
    AL357623, AL160169, AL356862 Genomic DNA. Translation: CAH72699.1.
    AL357623
    , AL160169, AL356862, AL450263 Genomic DNA. Translation: CAH72700.1.
    AL357623
    , AL160169, AL356862, AL450263 Genomic DNA. Translation: CAH72701.1.
    AL357623, AL160169, AL356862 Genomic DNA. Translation: CAH72702.1.
    AL356862, AL160169, AL357623 Genomic DNA. Translation: CAI39718.1.
    AL356862
    , AL160169, AL357623, AL450263 Genomic DNA. Translation: CAI39719.1.
    AL356862
    , AL160169, AL357623, AL450263 Genomic DNA. Translation: CAI39720.1.
    AL356862, AL160169, AL357623 Genomic DNA. Translation: CAI39721.1.
    AL356862, AL160169 Genomic DNA. Translation: CAI39723.1.
    AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI40638.1.
    AL160169
    , AL356862, AL357623, AL450263 Genomic DNA. Translation: CAI40639.1.
    AL160169
    , AL356862, AL357623, AL450263 Genomic DNA. Translation: CAI40640.1.
    AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI40641.1.
    AL160169, AL356862 Genomic DNA. Translation: CAI40643.1.
    AL160169 Genomic DNA. Translation: CAI40644.1.
    AL450263
    , AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI41460.1.
    AL450263
    , AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI41461.1.
    CH471090 Genomic DNA. Translation: EAW87645.1.
    CH471090 Genomic DNA. Translation: EAW87646.1.
    CH471090 Genomic DNA. Translation: EAW87648.1.
    BC019329 mRNA. Translation: AAH19329.1. Different initiation.
    BC032372 mRNA. Translation: AAH32372.1.
    BC033708 mRNA. Translation: AAH33708.1.
    CCDSiCCDS35143.1. [Q5JS13-1]
    CCDS55344.1. [Q5JS13-4]
    CCDS55345.1. [Q5JS13-7]
    CCDS55346.1. [Q5JS13-2]
    RefSeqiNP_001177657.1. NM_001190728.1. [Q5JS13-2]
    NP_001177658.1. NM_001190729.1. [Q5JS13-7]
    NP_001177659.1. NM_001190730.1. [Q5JS13-4]
    NP_055451.1. NM_014636.2. [Q5JS13-1]
    UniGeneiHs.432842.
    Hs.606576.
    Hs.721343.

    Genome annotation databases

    EnsembliENST00000259351; ENSP00000259351; ENSG00000136828. [Q5JS13-1]
    ENST00000373434; ENSP00000362533; ENSG00000136828. [Q5JS13-2]
    ENST00000373436; ENSP00000362535; ENSG00000136828. [Q5JS13-4]
    ENST00000394011; ENSP00000377579; ENSG00000136828. [Q5JS13-6]
    ENST00000394022; ENSP00000377590; ENSG00000136828. [Q5JS13-3]
    ENST00000424082; ENSP00000415630; ENSG00000136828. [Q5JS13-7]
    GeneIDi9649.
    KEGGihsa:9649.
    UCSCiuc004bqo.2. human. [Q5JS13-1]
    uc004bqq.4. human. [Q5JS13-2]
    uc011mab.2. human. [Q5JS13-3]
    uc011mac.2. human. [Q5JS13-7]
    uc022bno.1. human. [Q5JS13-4]

    Polymorphism databases

    DMDMi189040074.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF221098 mRNA. Translation: AAF65253.1 .
    AB002349 mRNA. Translation: BAA20808.2 . Different initiation.
    AK299149 mRNA. Translation: BAG61198.1 .
    AL357623 , AL160169 , AL356862 Genomic DNA. Translation: CAH72699.1 .
    AL357623
    , AL160169 , AL356862 , AL450263 Genomic DNA. Translation: CAH72700.1 .
    AL357623
    , AL160169 , AL356862 , AL450263 Genomic DNA. Translation: CAH72701.1 .
    AL357623 , AL160169 , AL356862 Genomic DNA. Translation: CAH72702.1 .
    AL356862 , AL160169 , AL357623 Genomic DNA. Translation: CAI39718.1 .
    AL356862
    , AL160169 , AL357623 , AL450263 Genomic DNA. Translation: CAI39719.1 .
    AL356862
    , AL160169 , AL357623 , AL450263 Genomic DNA. Translation: CAI39720.1 .
    AL356862 , AL160169 , AL357623 Genomic DNA. Translation: CAI39721.1 .
    AL356862 , AL160169 Genomic DNA. Translation: CAI39723.1 .
    AL160169 , AL356862 , AL357623 Genomic DNA. Translation: CAI40638.1 .
    AL160169
    , AL356862 , AL357623 , AL450263 Genomic DNA. Translation: CAI40639.1 .
    AL160169
    , AL356862 , AL357623 , AL450263 Genomic DNA. Translation: CAI40640.1 .
    AL160169 , AL356862 , AL357623 Genomic DNA. Translation: CAI40641.1 .
    AL160169 , AL356862 Genomic DNA. Translation: CAI40643.1 .
    AL160169 Genomic DNA. Translation: CAI40644.1 .
    AL450263
    , AL160169 , AL356862 , AL357623 Genomic DNA. Translation: CAI41460.1 .
    AL450263
    , AL160169 , AL356862 , AL357623 Genomic DNA. Translation: CAI41461.1 .
    CH471090 Genomic DNA. Translation: EAW87645.1 .
    CH471090 Genomic DNA. Translation: EAW87646.1 .
    CH471090 Genomic DNA. Translation: EAW87648.1 .
    BC019329 mRNA. Translation: AAH19329.1 . Different initiation.
    BC032372 mRNA. Translation: AAH32372.1 .
    BC033708 mRNA. Translation: AAH33708.1 .
    CCDSi CCDS35143.1. [Q5JS13-1 ]
    CCDS55344.1. [Q5JS13-4 ]
    CCDS55345.1. [Q5JS13-7 ]
    CCDS55346.1. [Q5JS13-2 ]
    RefSeqi NP_001177657.1. NM_001190728.1. [Q5JS13-2 ]
    NP_001177658.1. NM_001190729.1. [Q5JS13-7 ]
    NP_001177659.1. NM_001190730.1. [Q5JS13-4 ]
    NP_055451.1. NM_014636.2. [Q5JS13-1 ]
    UniGenei Hs.432842.
    Hs.606576.
    Hs.721343.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3QXL X-ray 2.24 A/B 23-289 [» ]
    ProteinModelPortali Q5JS13.
    SMRi Q5JS13. Positions 44-288, 432-547.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115007. 6 interactions.
    IntActi Q5JS13. 2 interactions.
    MINTi MINT-7968995.

    PTM databases

    PhosphoSitei Q5JS13.

    Polymorphism databases

    DMDMi 189040074.

    Proteomic databases

    MaxQBi Q5JS13.
    PaxDbi Q5JS13.
    PRIDEi Q5JS13.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000259351 ; ENSP00000259351 ; ENSG00000136828 . [Q5JS13-1 ]
    ENST00000373434 ; ENSP00000362533 ; ENSG00000136828 . [Q5JS13-2 ]
    ENST00000373436 ; ENSP00000362535 ; ENSG00000136828 . [Q5JS13-4 ]
    ENST00000394011 ; ENSP00000377579 ; ENSG00000136828 . [Q5JS13-6 ]
    ENST00000394022 ; ENSP00000377590 ; ENSG00000136828 . [Q5JS13-3 ]
    ENST00000424082 ; ENSP00000415630 ; ENSG00000136828 . [Q5JS13-7 ]
    GeneIDi 9649.
    KEGGi hsa:9649.
    UCSCi uc004bqo.2. human. [Q5JS13-1 ]
    uc004bqq.4. human. [Q5JS13-2 ]
    uc011mab.2. human. [Q5JS13-3 ]
    uc011mac.2. human. [Q5JS13-7 ]
    uc022bno.1. human. [Q5JS13-4 ]

    Organism-specific databases

    CTDi 9649.
    GeneCardsi GC09P129679.
    HGNCi HGNC:16851. RALGPS1.
    MIMi 614444. gene.
    neXtProti NX_Q5JS13.
    PharmGKBi PA134907502.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG275669.
    HOVERGENi HBG059258.
    InParanoidi Q5JS13.
    OMAi APNIVAF.
    OrthoDBi EOG70KGP7.
    PhylomeDBi Q5JS13.
    TreeFami TF352150.

    Miscellaneous databases

    GenomeRNAii 9649.
    NextBioi 36221.
    PROi Q5JS13.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q5JS13.
    Bgeei Q5JS13.
    CleanExi HS_RALGPS1.
    Genevestigatori Q5JS13.

    Family and domain databases

    Gene3Di 1.10.840.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProi IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR023578. Ras_GEF_dom.
    IPR001895. RasGRF_CDC25.
    [Graphical view ]
    Pfami PF00169. PH. 1 hit.
    PF00617. RasGEF. 1 hit.
    [Graphical view ]
    SMARTi SM00233. PH. 1 hit.
    SM00147. RasGEF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48366. SSF48366. 1 hit.
    PROSITEi PS50003. PH_DOMAIN. 1 hit.
    PS50009. RASGEF_CAT. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of a new family of guanine nucleotide exchange factors for the ras-related GTPase Ral."
      Rebhun J.F., Chen H., Quilliam L.A.
      J. Biol. Chem. 275:13406-13410(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH GRB2; NCK1; PLCG1; RALA AND SRC, TISSUE SPECIFICITY.
      Tissue: Small intestine.
    2. "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
    4. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 6).
      Tissue: Brain and Pancreas.
    7. "RalGEF2, a pleckstrin homology domain containing guanine nucleotide exchange factor for Ral."
      de Bruyn K.M., de Rooij J., Wolthuis R.M., Rehmann H., Wesenbeek J., Cool R.H., Wittinghofer A.H., Bos J.L.
      J. Biol. Chem. 275:29761-29766(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF LEU-148.
    8. "Structural study of the Cdc25 domain from Ral-specific guanine-nucleotide exchange factor RalGPS1a."
      Peng W., Xu J., Guan X., Sun Y., Zhang X.C., Li X., Rao Z.
      Protein Cell 2:308-319(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.24 ANGSTROMS) OF 23-289.

    Entry informationi

    Entry nameiRGPS1_HUMAN
    AccessioniPrimary (citable) accession number: Q5JS13
    Secondary accession number(s): B4DR86
    , E9PBQ5, O15059, Q5JT60, Q5JT65, Q5JUG5, Q8N4S6, Q8N5H4, Q8WUV7, Q9NZ16
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 20, 2008
    Last sequence update: February 5, 2008
    Last modified: October 1, 2014
    This is version 69 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3