Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5JS13

- RGPS1_HUMAN

UniProt

Q5JS13 - RGPS1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Ras-specific guanine nucleotide-releasing factor RalGPS1

Gene

RALGPS1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization (By similarity). Guanine nucleotide exchange factor for.By similarity2 Publications

GO - Molecular functioni

  1. guanyl-nucleotide exchange factor activity Source: UniProtKB
  2. Ral guanyl-nucleotide exchange factor activity Source: FlyBase

GO - Biological processi

  1. intracellular signal transduction Source: UniProtKB
  2. positive regulation of GTPase activity Source: GOC
  3. positive regulation of Ral GTPase activity Source: GOC
  4. regulation of Ral protein signal transduction Source: FlyBase
  5. small GTPase mediated signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-specific guanine nucleotide-releasing factor RalGPS1
Alternative name(s):
Ral GEF with PH domain and SH3-binding motif 1
Ral guanine nucleotide exchange factor 2
Short name:
RalGEF 2
RalA exchange factor RalGPS1
Gene namesi
Name:RALGPS1
Synonyms:KIAA0351, RALGEF2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:16851. RALGPS1.

Subcellular locationi

Cytoplasm 1 Publication. Cell membrane 1 Publication
Note: Associates with membranes through the PH domain.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi148 – 1481L → A: Loss of activity. 1 Publication

Organism-specific databases

PharmGKBiPA134907502.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 557557Ras-specific guanine nucleotide-releasing factor RalGPS1PRO_0000333192Add
BLAST

Proteomic databases

MaxQBiQ5JS13.
PaxDbiQ5JS13.
PRIDEiQ5JS13.

PTM databases

PhosphoSiteiQ5JS13.

Expressioni

Tissue specificityi

Widely expressed (at protein level). Isoform 2 is expressed in brain, colon, kidney, pancreas, prostate, skeletal muscle, small intestine, testis, thymus and uterus. Isoform 1 is expressed at high levels in heart and testis and at lower levels in brain, pancreas, skeletal muscle, small intestine and thymus.2 Publications

Gene expression databases

BgeeiQ5JS13.
CleanExiHS_RALGPS1.
ExpressionAtlasiQ5JS13. baseline and differential.
GenevestigatoriQ5JS13.

Interactioni

Subunit structurei

Interacts with the SH3 domains of GRB2, NCK1, PLCG1 and SRC.1 Publication

Protein-protein interaction databases

BioGridi115007. 6 interactions.
IntActiQ5JS13. 2 interactions.
MINTiMINT-7968995.

Structurei

Secondary structure

1
557
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi46 – 483Combined sources
Helixi51 – 6717Combined sources
Helixi71 – 766Combined sources
Helixi84 – 874Combined sources
Helixi89 – 11022Combined sources
Helixi115 – 13420Combined sources
Helixi138 – 14811Combined sources
Helixi151 – 1544Combined sources
Helixi157 – 1615Combined sources
Helixi165 – 17713Combined sources
Helixi181 – 19212Combined sources
Turni193 – 1964Combined sources
Helixi203 – 21614Combined sources
Beta strandi219 – 2213Combined sources
Helixi223 – 24523Combined sources
Helixi256 – 2638Combined sources
Helixi269 – 2713Combined sources
Helixi272 – 28615Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3QXLX-ray2.24A/B23-289[»]
ProteinModelPortaliQ5JS13.
SMRiQ5JS13. Positions 44-288, 432-547.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini50 – 289240Ras-GEFPROSITE-ProRule annotationAdd
BLAST
Domaini431 – 543113PHPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni433 – 557125Required for stimulation of nucleotide exchange by RALAAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi330 – 3334PXXP

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi21 – 266Poly-Ser

Domaini

The PH domain mediates binding to membranes. It is required for efficient GEF activity.

Sequence similaritiesi

Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG275669.
GeneTreeiENSGT00770000120448.
HOVERGENiHBG059258.
InParanoidiQ5JS13.
OMAiAPNIVAF.
OrthoDBiEOG70KGP7.
PhylomeDBiQ5JS13.
TreeFamiTF352150.

Family and domain databases

Gene3Di1.10.840.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00617. RasGEF. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00147. RasGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5JS13-1) [UniParc]FASTAAdd to Basket

Also known as: RALGPS1B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYKRNGLMAS VLVTSATPQG SSSSDSLEGQ SCDYASKSYD AVVFDVLKVT
60 70 80 90 100
PEEFASQITL MDIPVFKAIQ PEELASCGWS KKEKHSLAPN VVAFTRRFNQ
110 120 130 140 150
VSFWVVREIL TAQTLKIRAE ILSHFVKIAK KLLELNNLHS LMSVVSALQS
160 170 180 190 200
APIFRLTKTW ALLNRKDKTT FEKLDYLMSK EDNYKRTREY IRSLKMVPSI
210 220 230 240 250
PYLGIYLLDL IYIDSAYPAS GSIMENEQRS NQMNNILRII ADLQVSCSYD
260 270 280 290 300
HLTTLPHVQK YLKSVRYIEE LQKFVEDDNY KLSLRIEPGS SSPRLVSSKE
310 320 330 340 350
DLAGPSAGSG SARFSRRPTC PDTSVAGSLP TPPVPRHRKS HSLGNNMMCQ
360 370 380 390 400
LSVVESKSAT FPSEKARHLL DDSVLESRSP RRGLALTSSS AVTNGLSLGS
410 420 430 440 450
SESSEFSEEM SSGLESPTGP CICSLGNSAA VPTMEGPLRR KTLLKEGRKP
460 470 480 490 500
ALSSWTRYWV ILSGSTLLYY GAKSLRGTDR KHYKSTPGKK VSIVGWMVQL
510 520 530 540 550
PDDPEHPDIF QLNNPDKGNV YKFQTGSRFH AILWHKHLDD ACKSNRPQVP

ANLMSFE
Length:557
Mass (Da):62,133
Last modified:February 5, 2008 - v1
Checksum:i0C93A55468ED95ED
GO
Isoform 2 (identifier: Q5JS13-2) [UniParc]FASTAAdd to Basket

Also known as: RALGPS1A

The sequence of this isoform differs from the canonical sequence as follows:
     347-415: MMCQLSVVES...FSEEMSSGLE → RGRLYATLGPNWRVPVRNSPRTRSCVY
     483-490: Missing.
     549-557: VPANLMSFE → EAGAAPGPTGTDSHEVDHLEGGAGKEAGPCA

Note: No experimental confirmation available.

Show »
Length:529
Mass (Da):58,975
Checksum:i49CFB803DABF6BAA
GO
Isoform 3 (identifier: Q5JS13-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-384: GPSAGSGSAR...LESRSPRRGL → VSHLSSLSHQ...TLGSRSRRIT
     385-557: Missing.

Note: No experimental confirmation available.

Show »
Length:384
Mass (Da):43,154
Checksum:i2B0F6988D850036E
GO
Isoform 4 (identifier: Q5JS13-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-305: GP → AM
     306-557: Missing.

Note: No experimental confirmation available.

Show »
Length:305
Mass (Da):34,728
Checksum:iA23253E8A5E97706
GO
Isoform 5 (identifier: Q5JS13-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     205-213: IYLLDLIYI → RSLNWLIFF
     214-557: Missing.

Note: Gene prediction based on EST data. No experimental confirmation available.

Show »
Length:213
Mass (Da):24,325
Checksum:i6BE4541C45159E89
GO
Isoform 6 (identifier: Q5JS13-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-108: ELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVRE → KGWPARMEDSLQKSTVSSRPHDTLQFRKTLPVGPGT
     109-557: Missing.

Note: No experimental confirmation available.

Show »
Length:108
Mass (Da):11,772
Checksum:i96CA60064D585BB5
GO
Isoform 7 (identifier: Q5JS13-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-415: MMCQLSVVES...FSEEMSSGLE → RGRLYATLGPNWRVPVRNSPRTRSCVY
     549-557: VPANLMSFE → EAGAAPGPTGTDSHEVDHLEGGAGKEAGPCA

Note: No experimental confirmation available.

Show »
Length:537
Mass (Da):59,865
Checksum:i3CCD9778267F43FA
GO

Sequence cautioni

The sequence AAH19329.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAA20808.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti86 – 861S → T in AAH32372. (PubMed:15489334)Curated
Sequence conflicti189 – 1891E → G in BAG61198. (PubMed:14702039)Curated
Sequence conflicti251 – 2511H → R in BAG61198. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti290 – 2901S → N.
Corresponds to variant rs55918931 [ dbSNP | Ensembl ].
VAR_061785

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei73 – 10836ELASC…WVVRE → KGWPARMEDSLQKSTVSSRP HDTLQFRKTLPVGPGT in isoform 6. 1 PublicationVSP_033471Add
BLAST
Alternative sequencei109 – 557449Missing in isoform 6. 1 PublicationVSP_033472Add
BLAST
Alternative sequencei205 – 2139IYLLDLIYI → RSLNWLIFF in isoform 5. CuratedVSP_033473
Alternative sequencei214 – 557344Missing in isoform 5. CuratedVSP_033474Add
BLAST
Alternative sequencei304 – 38481GPSAG…PRRGL → VSHLSSLSHQGQAEEARLKP TSGQHPAWMWPSSSRVPAAP PASAAPRSPWPRNLRNDQGQ PGAVALTCNPSTLGSRSRRI T in isoform 3. 1 PublicationVSP_033475Add
BLAST
Alternative sequencei304 – 3052GP → AM in isoform 4. 1 PublicationVSP_033476
Alternative sequencei306 – 557252Missing in isoform 4. 1 PublicationVSP_033477Add
BLAST
Alternative sequencei347 – 41569MMCQL…SSGLE → RGRLYATLGPNWRVPVRNSP RTRSCVY in isoform 2 and isoform 7. 2 PublicationsVSP_033478Add
BLAST
Alternative sequencei385 – 557173Missing in isoform 3. 1 PublicationVSP_033479Add
BLAST
Alternative sequencei483 – 4908Missing in isoform 2. 1 PublicationVSP_033480
Alternative sequencei549 – 5579VPANLMSFE → EAGAAPGPTGTDSHEVDHLE GGAGKEAGPCA in isoform 2 and isoform 7. 2 PublicationsVSP_033481

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF221098 mRNA. Translation: AAF65253.1.
AB002349 mRNA. Translation: BAA20808.2. Different initiation.
AK299149 mRNA. Translation: BAG61198.1.
AL357623, AL160169, AL356862 Genomic DNA. Translation: CAH72699.1.
AL357623
, AL160169, AL356862, AL450263 Genomic DNA. Translation: CAH72700.1.
AL357623
, AL160169, AL356862, AL450263 Genomic DNA. Translation: CAH72701.1.
AL357623, AL160169, AL356862 Genomic DNA. Translation: CAH72702.1.
AL356862, AL160169, AL357623 Genomic DNA. Translation: CAI39718.1.
AL356862
, AL160169, AL357623, AL450263 Genomic DNA. Translation: CAI39719.1.
AL356862
, AL160169, AL357623, AL450263 Genomic DNA. Translation: CAI39720.1.
AL356862, AL160169, AL357623 Genomic DNA. Translation: CAI39721.1.
AL356862, AL160169 Genomic DNA. Translation: CAI39723.1.
AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI40638.1.
AL160169
, AL356862, AL357623, AL450263 Genomic DNA. Translation: CAI40639.1.
AL160169
, AL356862, AL357623, AL450263 Genomic DNA. Translation: CAI40640.1.
AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI40641.1.
AL160169, AL356862 Genomic DNA. Translation: CAI40643.1.
AL160169 Genomic DNA. Translation: CAI40644.1.
AL450263
, AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI41460.1.
AL450263
, AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI41461.1.
CH471090 Genomic DNA. Translation: EAW87645.1.
CH471090 Genomic DNA. Translation: EAW87646.1.
CH471090 Genomic DNA. Translation: EAW87648.1.
BC019329 mRNA. Translation: AAH19329.1. Different initiation.
BC032372 mRNA. Translation: AAH32372.1.
BC033708 mRNA. Translation: AAH33708.1.
CCDSiCCDS35143.1. [Q5JS13-1]
CCDS55344.1. [Q5JS13-4]
CCDS55345.1. [Q5JS13-7]
CCDS55346.1. [Q5JS13-2]
RefSeqiNP_001177657.1. NM_001190728.1. [Q5JS13-2]
NP_001177658.1. NM_001190729.1. [Q5JS13-7]
NP_001177659.1. NM_001190730.1. [Q5JS13-4]
NP_055451.1. NM_014636.2. [Q5JS13-1]
UniGeneiHs.432842.
Hs.606576.
Hs.721343.

Genome annotation databases

EnsembliENST00000259351; ENSP00000259351; ENSG00000136828. [Q5JS13-1]
ENST00000373434; ENSP00000362533; ENSG00000136828. [Q5JS13-2]
ENST00000373436; ENSP00000362535; ENSG00000136828. [Q5JS13-4]
ENST00000394011; ENSP00000377579; ENSG00000136828. [Q5JS13-6]
ENST00000394022; ENSP00000377590; ENSG00000136828. [Q5JS13-3]
ENST00000424082; ENSP00000415630; ENSG00000136828. [Q5JS13-7]
GeneIDi9649.
KEGGihsa:9649.
UCSCiuc004bqo.2. human. [Q5JS13-1]
uc004bqq.4. human. [Q5JS13-2]
uc011mab.2. human. [Q5JS13-3]
uc011mac.2. human. [Q5JS13-7]
uc022bno.1. human. [Q5JS13-4]

Polymorphism databases

DMDMi189040074.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF221098 mRNA. Translation: AAF65253.1 .
AB002349 mRNA. Translation: BAA20808.2 . Different initiation.
AK299149 mRNA. Translation: BAG61198.1 .
AL357623 , AL160169 , AL356862 Genomic DNA. Translation: CAH72699.1 .
AL357623
, AL160169 , AL356862 , AL450263 Genomic DNA. Translation: CAH72700.1 .
AL357623
, AL160169 , AL356862 , AL450263 Genomic DNA. Translation: CAH72701.1 .
AL357623 , AL160169 , AL356862 Genomic DNA. Translation: CAH72702.1 .
AL356862 , AL160169 , AL357623 Genomic DNA. Translation: CAI39718.1 .
AL356862
, AL160169 , AL357623 , AL450263 Genomic DNA. Translation: CAI39719.1 .
AL356862
, AL160169 , AL357623 , AL450263 Genomic DNA. Translation: CAI39720.1 .
AL356862 , AL160169 , AL357623 Genomic DNA. Translation: CAI39721.1 .
AL356862 , AL160169 Genomic DNA. Translation: CAI39723.1 .
AL160169 , AL356862 , AL357623 Genomic DNA. Translation: CAI40638.1 .
AL160169
, AL356862 , AL357623 , AL450263 Genomic DNA. Translation: CAI40639.1 .
AL160169
, AL356862 , AL357623 , AL450263 Genomic DNA. Translation: CAI40640.1 .
AL160169 , AL356862 , AL357623 Genomic DNA. Translation: CAI40641.1 .
AL160169 , AL356862 Genomic DNA. Translation: CAI40643.1 .
AL160169 Genomic DNA. Translation: CAI40644.1 .
AL450263
, AL160169 , AL356862 , AL357623 Genomic DNA. Translation: CAI41460.1 .
AL450263
, AL160169 , AL356862 , AL357623 Genomic DNA. Translation: CAI41461.1 .
CH471090 Genomic DNA. Translation: EAW87645.1 .
CH471090 Genomic DNA. Translation: EAW87646.1 .
CH471090 Genomic DNA. Translation: EAW87648.1 .
BC019329 mRNA. Translation: AAH19329.1 . Different initiation.
BC032372 mRNA. Translation: AAH32372.1 .
BC033708 mRNA. Translation: AAH33708.1 .
CCDSi CCDS35143.1. [Q5JS13-1 ]
CCDS55344.1. [Q5JS13-4 ]
CCDS55345.1. [Q5JS13-7 ]
CCDS55346.1. [Q5JS13-2 ]
RefSeqi NP_001177657.1. NM_001190728.1. [Q5JS13-2 ]
NP_001177658.1. NM_001190729.1. [Q5JS13-7 ]
NP_001177659.1. NM_001190730.1. [Q5JS13-4 ]
NP_055451.1. NM_014636.2. [Q5JS13-1 ]
UniGenei Hs.432842.
Hs.606576.
Hs.721343.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3QXL X-ray 2.24 A/B 23-289 [» ]
ProteinModelPortali Q5JS13.
SMRi Q5JS13. Positions 44-288, 432-547.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115007. 6 interactions.
IntActi Q5JS13. 2 interactions.
MINTi MINT-7968995.

PTM databases

PhosphoSitei Q5JS13.

Polymorphism databases

DMDMi 189040074.

Proteomic databases

MaxQBi Q5JS13.
PaxDbi Q5JS13.
PRIDEi Q5JS13.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000259351 ; ENSP00000259351 ; ENSG00000136828 . [Q5JS13-1 ]
ENST00000373434 ; ENSP00000362533 ; ENSG00000136828 . [Q5JS13-2 ]
ENST00000373436 ; ENSP00000362535 ; ENSG00000136828 . [Q5JS13-4 ]
ENST00000394011 ; ENSP00000377579 ; ENSG00000136828 . [Q5JS13-6 ]
ENST00000394022 ; ENSP00000377590 ; ENSG00000136828 . [Q5JS13-3 ]
ENST00000424082 ; ENSP00000415630 ; ENSG00000136828 . [Q5JS13-7 ]
GeneIDi 9649.
KEGGi hsa:9649.
UCSCi uc004bqo.2. human. [Q5JS13-1 ]
uc004bqq.4. human. [Q5JS13-2 ]
uc011mab.2. human. [Q5JS13-3 ]
uc011mac.2. human. [Q5JS13-7 ]
uc022bno.1. human. [Q5JS13-4 ]

Organism-specific databases

CTDi 9649.
GeneCardsi GC09P129679.
HGNCi HGNC:16851. RALGPS1.
MIMi 614444. gene.
neXtProti NX_Q5JS13.
PharmGKBi PA134907502.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG275669.
GeneTreei ENSGT00770000120448.
HOVERGENi HBG059258.
InParanoidi Q5JS13.
OMAi APNIVAF.
OrthoDBi EOG70KGP7.
PhylomeDBi Q5JS13.
TreeFami TF352150.

Miscellaneous databases

ChiTaRSi RALGPS1. human.
GenomeRNAii 9649.
NextBioi 36221.
PROi Q5JS13.
SOURCEi Search...

Gene expression databases

Bgeei Q5JS13.
CleanExi HS_RALGPS1.
ExpressionAtlasi Q5JS13. baseline and differential.
Genevestigatori Q5JS13.

Family and domain databases

Gene3Di 1.10.840.10. 1 hit.
2.30.29.30. 1 hit.
InterProi IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view ]
Pfami PF00169. PH. 1 hit.
PF00617. RasGEF. 1 hit.
[Graphical view ]
SMARTi SM00233. PH. 1 hit.
SM00147. RasGEF. 1 hit.
[Graphical view ]
SUPFAMi SSF48366. SSF48366. 1 hit.
PROSITEi PS50003. PH_DOMAIN. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of a new family of guanine nucleotide exchange factors for the ras-related GTPase Ral."
    Rebhun J.F., Chen H., Quilliam L.A.
    J. Biol. Chem. 275:13406-13410(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH GRB2; NCK1; PLCG1; RALA AND SRC, TISSUE SPECIFICITY.
    Tissue: Small intestine.
  2. "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
  4. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 6).
    Tissue: Brain and Pancreas.
  7. "RalGEF2, a pleckstrin homology domain containing guanine nucleotide exchange factor for Ral."
    de Bruyn K.M., de Rooij J., Wolthuis R.M., Rehmann H., Wesenbeek J., Cool R.H., Wittinghofer A.H., Bos J.L.
    J. Biol. Chem. 275:29761-29766(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF LEU-148.
  8. "Structural study of the Cdc25 domain from Ral-specific guanine-nucleotide exchange factor RalGPS1a."
    Peng W., Xu J., Guan X., Sun Y., Zhang X.C., Li X., Rao Z.
    Protein Cell 2:308-319(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.24 ANGSTROMS) OF 23-289.

Entry informationi

Entry nameiRGPS1_HUMAN
AccessioniPrimary (citable) accession number: Q5JS13
Secondary accession number(s): B4DR86
, E9PBQ5, O15059, Q5JT60, Q5JT65, Q5JUG5, Q8N4S6, Q8N5H4, Q8WUV7, Q9NZ16
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: February 5, 2008
Last modified: November 26, 2014
This is version 71 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3