Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5JS13 (RGPS1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 67. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ras-specific guanine nucleotide-releasing factor RalGPS1
Alternative name(s):
Ral GEF with PH domain and SH3-binding motif 1
Ral guanine nucleotide exchange factor 2
Short name=RalGEF 2
RalA exchange factor RalGPS1
Gene names
Name:RALGPS1
Synonyms:KIAA0351, RALGEF2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length557 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization By similarity. Guanine nucleotide exchange factor for. Ref.1 Ref.7

Subunit structure

Interacts with the SH3 domains of GRB2, NCK1, PLCG1 and SRC. Ref.1

Subcellular location

Cytoplasm. Cell membrane. Note: Associates with membranes through the PH domain. Ref.7

Tissue specificity

Widely expressed (at protein level). Isoform 2 is expressed in brain, colon, kidney, pancreas, prostate, skeletal muscle, small intestine, testis, thymus and uterus. Isoform 1 is expressed at high levels in heart and testis and at lower levels in brain, pancreas, skeletal muscle, small intestine and thymus. Ref.1 Ref.7

Domain

The PH domain mediates binding to membranes. It is required for efficient GEF activity.

Sequence similarities

Contains 1 PH domain.

Contains 1 Ras-GEF domain.

Sequence caution

The sequence AAH19329.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence BAA20808.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5JS13-1)

Also known as: RALGPS1B;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5JS13-2)

Also known as: RALGPS1A;

The sequence of this isoform differs from the canonical sequence as follows:
     347-415: MMCQLSVVES...FSEEMSSGLE → RGRLYATLGPNWRVPVRNSPRTRSCVY
     483-490: Missing.
     549-557: VPANLMSFE → EAGAAPGPTGTDSHEVDHLEGGAGKEAGPCA
Note: No experimental confirmation available.
Isoform 3 (identifier: Q5JS13-3)

The sequence of this isoform differs from the canonical sequence as follows:
     304-384: GPSAGSGSAR...LESRSPRRGL → VSHLSSLSHQ...TLGSRSRRIT
     385-557: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q5JS13-4)

The sequence of this isoform differs from the canonical sequence as follows:
     304-305: GP → AM
     306-557: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q5JS13-5)

The sequence of this isoform differs from the canonical sequence as follows:
     205-213: IYLLDLIYI → RSLNWLIFF
     214-557: Missing.
Note: Gene prediction based on EST data. No experimental confirmation available.
Isoform 6 (identifier: Q5JS13-6)

The sequence of this isoform differs from the canonical sequence as follows:
     73-108: ELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVRE → KGWPARMEDSLQKSTVSSRPHDTLQFRKTLPVGPGT
     109-557: Missing.
Note: No experimental confirmation available.
Isoform 7 (identifier: Q5JS13-7)

The sequence of this isoform differs from the canonical sequence as follows:
     347-415: MMCQLSVVES...FSEEMSSGLE → RGRLYATLGPNWRVPVRNSPRTRSCVY
     549-557: VPANLMSFE → EAGAAPGPTGTDSHEVDHLEGGAGKEAGPCA
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 557557Ras-specific guanine nucleotide-releasing factor RalGPS1
PRO_0000333192

Regions

Domain50 – 289240Ras-GEF
Domain431 – 543113PH
Region433 – 557125Required for stimulation of nucleotide exchange by RALA
Motif330 – 3334PXXP
Compositional bias21 – 266Poly-Ser

Natural variations

Alternative sequence73 – 10836ELASC…WVVRE → KGWPARMEDSLQKSTVSSRP HDTLQFRKTLPVGPGT in isoform 6.
VSP_033471
Alternative sequence109 – 557449Missing in isoform 6.
VSP_033472
Alternative sequence205 – 2139IYLLDLIYI → RSLNWLIFF in isoform 5.
VSP_033473
Alternative sequence214 – 557344Missing in isoform 5.
VSP_033474
Alternative sequence304 – 38481GPSAG…PRRGL → VSHLSSLSHQGQAEEARLKP TSGQHPAWMWPSSSRVPAAP PASAAPRSPWPRNLRNDQGQ PGAVALTCNPSTLGSRSRRI T in isoform 3.
VSP_033475
Alternative sequence304 – 3052GP → AM in isoform 4.
VSP_033476
Alternative sequence306 – 557252Missing in isoform 4.
VSP_033477
Alternative sequence347 – 41569MMCQL…SSGLE → RGRLYATLGPNWRVPVRNSP RTRSCVY in isoform 2 and isoform 7.
VSP_033478
Alternative sequence385 – 557173Missing in isoform 3.
VSP_033479
Alternative sequence483 – 4908Missing in isoform 2.
VSP_033480
Alternative sequence549 – 5579VPANLMSFE → EAGAAPGPTGTDSHEVDHLE GGAGKEAGPCA in isoform 2 and isoform 7.
VSP_033481
Natural variant2901S → N.
Corresponds to variant rs55918931 [ dbSNP | Ensembl ].
VAR_061785

Experimental info

Mutagenesis1481L → A: Loss of activity. Ref.7
Sequence conflict861S → T in AAH32372. Ref.6
Sequence conflict1891E → G in BAG61198. Ref.3
Sequence conflict2511H → R in BAG61198. Ref.3

Secondary structure

................................... 557
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (RALGPS1B) [UniParc].

Last modified February 5, 2008. Version 1.
Checksum: 0C93A55468ED95ED

FASTA55762,133
        10         20         30         40         50         60 
MYKRNGLMAS VLVTSATPQG SSSSDSLEGQ SCDYASKSYD AVVFDVLKVT PEEFASQITL 

        70         80         90        100        110        120 
MDIPVFKAIQ PEELASCGWS KKEKHSLAPN VVAFTRRFNQ VSFWVVREIL TAQTLKIRAE 

       130        140        150        160        170        180 
ILSHFVKIAK KLLELNNLHS LMSVVSALQS APIFRLTKTW ALLNRKDKTT FEKLDYLMSK 

       190        200        210        220        230        240 
EDNYKRTREY IRSLKMVPSI PYLGIYLLDL IYIDSAYPAS GSIMENEQRS NQMNNILRII 

       250        260        270        280        290        300 
ADLQVSCSYD HLTTLPHVQK YLKSVRYIEE LQKFVEDDNY KLSLRIEPGS SSPRLVSSKE 

       310        320        330        340        350        360 
DLAGPSAGSG SARFSRRPTC PDTSVAGSLP TPPVPRHRKS HSLGNNMMCQ LSVVESKSAT 

       370        380        390        400        410        420 
FPSEKARHLL DDSVLESRSP RRGLALTSSS AVTNGLSLGS SESSEFSEEM SSGLESPTGP 

       430        440        450        460        470        480 
CICSLGNSAA VPTMEGPLRR KTLLKEGRKP ALSSWTRYWV ILSGSTLLYY GAKSLRGTDR 

       490        500        510        520        530        540 
KHYKSTPGKK VSIVGWMVQL PDDPEHPDIF QLNNPDKGNV YKFQTGSRFH AILWHKHLDD 

       550 
ACKSNRPQVP ANLMSFE 

« Hide

Isoform 2 (RALGPS1A) [UniParc].

Checksum: 49CFB803DABF6BAA
Show »

FASTA52958,975
Isoform 3 [UniParc].

Checksum: 2B0F6988D850036E
Show »

FASTA38443,154
Isoform 4 [UniParc].

Checksum: A23253E8A5E97706
Show »

FASTA30534,728
Isoform 5 [UniParc].

Checksum: 6BE4541C45159E89
Show »

FASTA21324,325
Isoform 6 [UniParc].

Checksum: 96CA60064D585BB5
Show »

FASTA10811,772
Isoform 7 [UniParc].

Checksum: 3CCD9778267F43FA
Show »

FASTA53759,865

References

« Hide 'large scale' references
[1]"Identification and characterization of a new family of guanine nucleotide exchange factors for the ras-related GTPase Ral."
Rebhun J.F., Chen H., Quilliam L.A.
J. Biol. Chem. 275:13406-13410(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH GRB2; NCK1; PLCG1; RALA AND SRC, TISSUE SPECIFICITY.
Tissue: Small intestine.
[2]"Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
[4]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 6).
Tissue: Brain and Pancreas.
[7]"RalGEF2, a pleckstrin homology domain containing guanine nucleotide exchange factor for Ral."
de Bruyn K.M., de Rooij J., Wolthuis R.M., Rehmann H., Wesenbeek J., Cool R.H., Wittinghofer A.H., Bos J.L.
J. Biol. Chem. 275:29761-29766(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF LEU-148.
[8]"Structural study of the Cdc25 domain from Ral-specific guanine-nucleotide exchange factor RalGPS1a."
Peng W., Xu J., Guan X., Sun Y., Zhang X.C., Li X., Rao Z.
Protein Cell 2:308-319(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.24 ANGSTROMS) OF 23-289.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF221098 mRNA. Translation: AAF65253.1.
AB002349 mRNA. Translation: BAA20808.2. Different initiation.
AK299149 mRNA. Translation: BAG61198.1.
AL357623, AL160169, AL356862 Genomic DNA. Translation: CAH72699.1.
AL357623 expand/collapse EMBL AC list , AL160169, AL356862, AL450263 Genomic DNA. Translation: CAH72700.1.
AL357623 expand/collapse EMBL AC list , AL160169, AL356862, AL450263 Genomic DNA. Translation: CAH72701.1.
AL357623, AL160169, AL356862 Genomic DNA. Translation: CAH72702.1.
AL356862, AL160169, AL357623 Genomic DNA. Translation: CAI39718.1.
AL356862 expand/collapse EMBL AC list , AL160169, AL357623, AL450263 Genomic DNA. Translation: CAI39719.1.
AL356862 expand/collapse EMBL AC list , AL160169, AL357623, AL450263 Genomic DNA. Translation: CAI39720.1.
AL356862, AL160169, AL357623 Genomic DNA. Translation: CAI39721.1.
AL356862, AL160169 Genomic DNA. Translation: CAI39723.1.
AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI40638.1.
AL160169 expand/collapse EMBL AC list , AL356862, AL357623, AL450263 Genomic DNA. Translation: CAI40639.1.
AL160169 expand/collapse EMBL AC list , AL356862, AL357623, AL450263 Genomic DNA. Translation: CAI40640.1.
AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI40641.1.
AL160169, AL356862 Genomic DNA. Translation: CAI40643.1.
AL160169 Genomic DNA. Translation: CAI40644.1.
AL450263 expand/collapse EMBL AC list , AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI41460.1.
AL450263 expand/collapse EMBL AC list , AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI41461.1.
CH471090 Genomic DNA. Translation: EAW87645.1.
CH471090 Genomic DNA. Translation: EAW87646.1.
CH471090 Genomic DNA. Translation: EAW87648.1.
BC019329 mRNA. Translation: AAH19329.1. Different initiation.
BC032372 mRNA. Translation: AAH32372.1.
BC033708 mRNA. Translation: AAH33708.1.
CCDSCCDS35143.1. [Q5JS13-1]
CCDS55344.1. [Q5JS13-4]
CCDS55345.1. [Q5JS13-7]
CCDS55346.1. [Q5JS13-2]
RefSeqNP_001177657.1. NM_001190728.1. [Q5JS13-2]
NP_001177658.1. NM_001190729.1. [Q5JS13-7]
NP_001177659.1. NM_001190730.1. [Q5JS13-4]
NP_055451.1. NM_014636.2. [Q5JS13-1]
UniGeneHs.432842.
Hs.606576.
Hs.721343.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3QXLX-ray2.24A/B23-289[»]
ProteinModelPortalQ5JS13.
SMRQ5JS13. Positions 44-288, 432-547.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115007. 6 interactions.
IntActQ5JS13. 2 interactions.
MINTMINT-7968995.

PTM databases

PhosphoSiteQ5JS13.

Polymorphism databases

DMDM189040074.

Proteomic databases

MaxQBQ5JS13.
PaxDbQ5JS13.
PRIDEQ5JS13.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000259351; ENSP00000259351; ENSG00000136828. [Q5JS13-1]
ENST00000373434; ENSP00000362533; ENSG00000136828. [Q5JS13-2]
ENST00000373436; ENSP00000362535; ENSG00000136828. [Q5JS13-4]
ENST00000394011; ENSP00000377579; ENSG00000136828. [Q5JS13-6]
ENST00000394022; ENSP00000377590; ENSG00000136828. [Q5JS13-3]
ENST00000424082; ENSP00000415630; ENSG00000136828. [Q5JS13-7]
GeneID9649.
KEGGhsa:9649.
UCSCuc004bqo.2. human. [Q5JS13-1]
uc004bqq.4. human. [Q5JS13-2]
uc011mab.2. human. [Q5JS13-3]
uc011mac.2. human. [Q5JS13-7]
uc022bno.1. human. [Q5JS13-4]

Organism-specific databases

CTD9649.
GeneCardsGC09P129679.
HGNCHGNC:16851. RALGPS1.
MIM614444. gene.
neXtProtNX_Q5JS13.
PharmGKBPA134907502.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG275669.
HOVERGENHBG059258.
InParanoidQ5JS13.
OMAAPNIVAF.
OrthoDBEOG70KGP7.
PhylomeDBQ5JS13.
TreeFamTF352150.

Gene expression databases

ArrayExpressQ5JS13.
BgeeQ5JS13.
CleanExHS_RALGPS1.
GenevestigatorQ5JS13.

Family and domain databases

Gene3D1.10.840.10. 1 hit.
2.30.29.30. 1 hit.
InterProIPR011993. PH_like_dom.
IPR001849. Pleckstrin_homology.
IPR023578. Ras_GEF_dom.
IPR001895. RasGRF_CDC25.
[Graphical view]
PfamPF00169. PH. 1 hit.
PF00617. RasGEF. 1 hit.
[Graphical view]
SMARTSM00233. PH. 1 hit.
SM00147. RasGEF. 1 hit.
[Graphical view]
SUPFAMSSF48366. SSF48366. 1 hit.
PROSITEPS50003. PH_DOMAIN. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi9649.
NextBio36221.
PROQ5JS13.
SOURCESearch...

Entry information

Entry nameRGPS1_HUMAN
AccessionPrimary (citable) accession number: Q5JS13
Secondary accession number(s): B4DR86 expand/collapse secondary AC list , E9PBQ5, O15059, Q5JT60, Q5JT65, Q5JUG5, Q8N4S6, Q8N5H4, Q8WUV7, Q9NZ16
Entry history
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: February 5, 2008
Last modified: July 9, 2014
This is version 67 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM