Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-specific guanine nucleotide-releasing factor RalGPS1

Gene

RALGPS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization (By similarity). Guanine nucleotide exchange factor for.By similarity2 Publications

GO - Molecular functioni

  • guanyl-nucleotide exchange factor activity Source: UniProtKB
  • Ral guanyl-nucleotide exchange factor activity Source: FlyBase

GO - Biological processi

  • intracellular signal transduction Source: UniProtKB
  • regulation of Ral protein signal transduction Source: FlyBase
  • small GTPase mediated signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-specific guanine nucleotide-releasing factor RalGPS1
Alternative name(s):
Ral GEF with PH domain and SH3-binding motif 1
Ral guanine nucleotide exchange factor 2
Short name:
RalGEF 2
RalA exchange factor RalGPS1
Gene namesi
Name:RALGPS1
Synonyms:KIAA0351, RALGEF2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:16851. RALGPS1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi148L → A: Loss of activity. 1 Publication1

Organism-specific databases

DisGeNETi9649.
OpenTargetsiENSG00000136828.
PharmGKBiPA134907502.

Polymorphism and mutation databases

BioMutaiRALGPS1.
DMDMi189040074.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003331921 – 557Ras-specific guanine nucleotide-releasing factor RalGPS1Add BLAST557

Proteomic databases

MaxQBiQ5JS13.
PaxDbiQ5JS13.
PeptideAtlasiQ5JS13.
PRIDEiQ5JS13.

PTM databases

iPTMnetiQ5JS13.
PhosphoSitePlusiQ5JS13.

Expressioni

Tissue specificityi

Widely expressed (at protein level). Isoform 2 is expressed in brain, colon, kidney, pancreas, prostate, skeletal muscle, small intestine, testis, thymus and uterus. Isoform 1 is expressed at high levels in heart and testis and at lower levels in brain, pancreas, skeletal muscle, small intestine and thymus.2 Publications

Gene expression databases

BgeeiENSG00000136828.
CleanExiHS_RALGPS1.
ExpressionAtlasiQ5JS13. baseline and differential.
GenevisibleiQ5JS13. HS.

Organism-specific databases

HPAiCAB002682.

Interactioni

Subunit structurei

Interacts with the SH3 domains of GRB2, NCK1, PLCG1 and SRC.1 Publication

Protein-protein interaction databases

BioGridi115007. 6 interactors.
IntActiQ5JS13. 3 interactors.
MINTiMINT-7968995.
STRINGi9606.ENSP00000259351.

Structurei

Secondary structure

1557
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi46 – 48Combined sources3
Helixi51 – 67Combined sources17
Helixi71 – 76Combined sources6
Helixi84 – 87Combined sources4
Helixi89 – 110Combined sources22
Helixi115 – 134Combined sources20
Helixi138 – 148Combined sources11
Helixi151 – 154Combined sources4
Helixi157 – 161Combined sources5
Helixi165 – 177Combined sources13
Helixi181 – 192Combined sources12
Turni193 – 196Combined sources4
Helixi203 – 216Combined sources14
Beta strandi219 – 221Combined sources3
Helixi223 – 245Combined sources23
Helixi256 – 263Combined sources8
Helixi269 – 271Combined sources3
Helixi272 – 286Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3QXLX-ray2.24A/B23-289[»]
ProteinModelPortaliQ5JS13.
SMRiQ5JS13.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini50 – 289Ras-GEFPROSITE-ProRule annotationAdd BLAST240
Domaini431 – 543PHPROSITE-ProRule annotationAdd BLAST113

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni433 – 557Required for stimulation of nucleotide exchange by RALAAdd BLAST125

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi330 – 333PXXP4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi21 – 26Poly-Ser6

Domaini

The PH domain mediates binding to membranes. It is required for efficient GEF activity.

Sequence similaritiesi

Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410KD3E. Eukaryota.
ENOG410YV9P. LUCA.
GeneTreeiENSGT00860000133664.
HOGENOMiHOG000008021.
HOVERGENiHBG059258.
InParanoidiQ5JS13.
OMAiNQVSFWL.
OrthoDBiEOG091G0NUM.
PhylomeDBiQ5JS13.
TreeFamiTF352150.

Family and domain databases

CDDicd00155. RasGEF. 1 hit.
Gene3Di1.10.840.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00617. RasGEF. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00147. RasGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5JS13-1) [UniParc]FASTAAdd to basket
Also known as: RALGPS1B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYKRNGLMAS VLVTSATPQG SSSSDSLEGQ SCDYASKSYD AVVFDVLKVT
60 70 80 90 100
PEEFASQITL MDIPVFKAIQ PEELASCGWS KKEKHSLAPN VVAFTRRFNQ
110 120 130 140 150
VSFWVVREIL TAQTLKIRAE ILSHFVKIAK KLLELNNLHS LMSVVSALQS
160 170 180 190 200
APIFRLTKTW ALLNRKDKTT FEKLDYLMSK EDNYKRTREY IRSLKMVPSI
210 220 230 240 250
PYLGIYLLDL IYIDSAYPAS GSIMENEQRS NQMNNILRII ADLQVSCSYD
260 270 280 290 300
HLTTLPHVQK YLKSVRYIEE LQKFVEDDNY KLSLRIEPGS SSPRLVSSKE
310 320 330 340 350
DLAGPSAGSG SARFSRRPTC PDTSVAGSLP TPPVPRHRKS HSLGNNMMCQ
360 370 380 390 400
LSVVESKSAT FPSEKARHLL DDSVLESRSP RRGLALTSSS AVTNGLSLGS
410 420 430 440 450
SESSEFSEEM SSGLESPTGP CICSLGNSAA VPTMEGPLRR KTLLKEGRKP
460 470 480 490 500
ALSSWTRYWV ILSGSTLLYY GAKSLRGTDR KHYKSTPGKK VSIVGWMVQL
510 520 530 540 550
PDDPEHPDIF QLNNPDKGNV YKFQTGSRFH AILWHKHLDD ACKSNRPQVP

ANLMSFE
Length:557
Mass (Da):62,133
Last modified:February 5, 2008 - v1
Checksum:i0C93A55468ED95ED
GO
Isoform 2 (identifier: Q5JS13-2) [UniParc]FASTAAdd to basket
Also known as: RALGPS1A

The sequence of this isoform differs from the canonical sequence as follows:
     347-415: MMCQLSVVES...FSEEMSSGLE → RGRLYATLGPNWRVPVRNSPRTRSCVY
     483-490: Missing.
     549-557: VPANLMSFE → EAGAAPGPTGTDSHEVDHLEGGAGKEAGPCA

Note: No experimental confirmation available.
Show »
Length:529
Mass (Da):58,975
Checksum:i49CFB803DABF6BAA
GO
Isoform 3 (identifier: Q5JS13-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-384: GPSAGSGSAR...LESRSPRRGL → VSHLSSLSHQ...TLGSRSRRIT
     385-557: Missing.

Note: No experimental confirmation available.
Show »
Length:384
Mass (Da):43,154
Checksum:i2B0F6988D850036E
GO
Isoform 4 (identifier: Q5JS13-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-305: GP → AM
     306-557: Missing.

Note: No experimental confirmation available.
Show »
Length:305
Mass (Da):34,728
Checksum:iA23253E8A5E97706
GO
Isoform 5 (identifier: Q5JS13-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     205-213: IYLLDLIYI → RSLNWLIFF
     214-557: Missing.

Note: Gene prediction based on EST data. No experimental confirmation available.
Show »
Length:213
Mass (Da):24,325
Checksum:i6BE4541C45159E89
GO
Isoform 6 (identifier: Q5JS13-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-108: ELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVRE → KGWPARMEDSLQKSTVSSRPHDTLQFRKTLPVGPGT
     109-557: Missing.

Note: No experimental confirmation available.
Show »
Length:108
Mass (Da):11,772
Checksum:i96CA60064D585BB5
GO
Isoform 7 (identifier: Q5JS13-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-415: MMCQLSVVES...FSEEMSSGLE → RGRLYATLGPNWRVPVRNSPRTRSCVY
     549-557: VPANLMSFE → EAGAAPGPTGTDSHEVDHLEGGAGKEAGPCA

Note: No experimental confirmation available.
Show »
Length:537
Mass (Da):59,865
Checksum:i3CCD9778267F43FA
GO

Sequence cautioni

The sequence AAH19329 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAA20808 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti86S → T in AAH32372 (PubMed:15489334).Curated1
Sequence conflicti189E → G in BAG61198 (PubMed:14702039).Curated1
Sequence conflicti251H → R in BAG61198 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061785290S → N.Corresponds to variant rs55918931dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03347173 – 108ELASC…WVVRE → KGWPARMEDSLQKSTVSSRP HDTLQFRKTLPVGPGT in isoform 6. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_033472109 – 557Missing in isoform 6. 1 PublicationAdd BLAST449
Alternative sequenceiVSP_033473205 – 213IYLLDLIYI → RSLNWLIFF in isoform 5. Curated9
Alternative sequenceiVSP_033474214 – 557Missing in isoform 5. CuratedAdd BLAST344
Alternative sequenceiVSP_033475304 – 384GPSAG…PRRGL → VSHLSSLSHQGQAEEARLKP TSGQHPAWMWPSSSRVPAAP PASAAPRSPWPRNLRNDQGQ PGAVALTCNPSTLGSRSRRI T in isoform 3. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_033476304 – 305GP → AM in isoform 4. 1 Publication2
Alternative sequenceiVSP_033477306 – 557Missing in isoform 4. 1 PublicationAdd BLAST252
Alternative sequenceiVSP_033478347 – 415MMCQL…SSGLE → RGRLYATLGPNWRVPVRNSP RTRSCVY in isoform 2 and isoform 7. 2 PublicationsAdd BLAST69
Alternative sequenceiVSP_033479385 – 557Missing in isoform 3. 1 PublicationAdd BLAST173
Alternative sequenceiVSP_033480483 – 490Missing in isoform 2. 1 Publication8
Alternative sequenceiVSP_033481549 – 557VPANLMSFE → EAGAAPGPTGTDSHEVDHLE GGAGKEAGPCA in isoform 2 and isoform 7. 2 Publications9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF221098 mRNA. Translation: AAF65253.1.
AB002349 mRNA. Translation: BAA20808.2. Different initiation.
AK299149 mRNA. Translation: BAG61198.1.
AL357623, AL160169, AL356862 Genomic DNA. Translation: CAH72699.1.
AL357623
, AL160169, AL356862, AL450263 Genomic DNA. Translation: CAH72700.1.
AL357623
, AL160169, AL356862, AL450263 Genomic DNA. Translation: CAH72701.1.
AL357623, AL160169, AL356862 Genomic DNA. Translation: CAH72702.1.
AL356862, AL160169, AL357623 Genomic DNA. Translation: CAI39718.1.
AL356862
, AL160169, AL357623, AL450263 Genomic DNA. Translation: CAI39719.1.
AL356862
, AL160169, AL357623, AL450263 Genomic DNA. Translation: CAI39720.1.
AL356862, AL160169, AL357623 Genomic DNA. Translation: CAI39721.1.
AL356862, AL160169 Genomic DNA. Translation: CAI39723.1.
AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI40638.1.
AL160169
, AL356862, AL357623, AL450263 Genomic DNA. Translation: CAI40639.1.
AL160169
, AL356862, AL357623, AL450263 Genomic DNA. Translation: CAI40640.1.
AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI40641.1.
AL160169, AL356862 Genomic DNA. Translation: CAI40643.1.
AL160169 Genomic DNA. Translation: CAI40644.1.
AL450263
, AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI41460.1.
AL450263
, AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI41461.1.
CH471090 Genomic DNA. Translation: EAW87645.1.
CH471090 Genomic DNA. Translation: EAW87646.1.
CH471090 Genomic DNA. Translation: EAW87648.1.
BC019329 mRNA. Translation: AAH19329.1. Different initiation.
BC032372 mRNA. Translation: AAH32372.1.
BC033708 mRNA. Translation: AAH33708.1.
CCDSiCCDS35143.1. [Q5JS13-1]
CCDS55344.1. [Q5JS13-4]
CCDS55345.1. [Q5JS13-7]
CCDS55346.1. [Q5JS13-2]
RefSeqiNP_001177657.1. NM_001190728.1. [Q5JS13-2]
NP_001177658.1. NM_001190729.1. [Q5JS13-7]
NP_001177659.1. NM_001190730.1. [Q5JS13-4]
NP_001309249.1. NM_001322320.1. [Q5JS13-7]
NP_055451.1. NM_014636.2. [Q5JS13-1]
XP_016870836.1. XM_017015347.1. [Q5JS13-1]
XP_016870839.1. XM_017015350.1. [Q5JS13-3]
UniGeneiHs.432842.
Hs.606576.
Hs.721343.

Genome annotation databases

EnsembliENST00000259351; ENSP00000259351; ENSG00000136828. [Q5JS13-1]
ENST00000373434; ENSP00000362533; ENSG00000136828. [Q5JS13-2]
ENST00000373436; ENSP00000362535; ENSG00000136828. [Q5JS13-4]
ENST00000394011; ENSP00000377579; ENSG00000136828. [Q5JS13-6]
ENST00000394022; ENSP00000377590; ENSG00000136828. [Q5JS13-3]
ENST00000424082; ENSP00000415630; ENSG00000136828. [Q5JS13-7]
GeneIDi9649.
KEGGihsa:9649.
UCSCiuc004bqo.3. human. [Q5JS13-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF221098 mRNA. Translation: AAF65253.1.
AB002349 mRNA. Translation: BAA20808.2. Different initiation.
AK299149 mRNA. Translation: BAG61198.1.
AL357623, AL160169, AL356862 Genomic DNA. Translation: CAH72699.1.
AL357623
, AL160169, AL356862, AL450263 Genomic DNA. Translation: CAH72700.1.
AL357623
, AL160169, AL356862, AL450263 Genomic DNA. Translation: CAH72701.1.
AL357623, AL160169, AL356862 Genomic DNA. Translation: CAH72702.1.
AL356862, AL160169, AL357623 Genomic DNA. Translation: CAI39718.1.
AL356862
, AL160169, AL357623, AL450263 Genomic DNA. Translation: CAI39719.1.
AL356862
, AL160169, AL357623, AL450263 Genomic DNA. Translation: CAI39720.1.
AL356862, AL160169, AL357623 Genomic DNA. Translation: CAI39721.1.
AL356862, AL160169 Genomic DNA. Translation: CAI39723.1.
AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI40638.1.
AL160169
, AL356862, AL357623, AL450263 Genomic DNA. Translation: CAI40639.1.
AL160169
, AL356862, AL357623, AL450263 Genomic DNA. Translation: CAI40640.1.
AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI40641.1.
AL160169, AL356862 Genomic DNA. Translation: CAI40643.1.
AL160169 Genomic DNA. Translation: CAI40644.1.
AL450263
, AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI41460.1.
AL450263
, AL160169, AL356862, AL357623 Genomic DNA. Translation: CAI41461.1.
CH471090 Genomic DNA. Translation: EAW87645.1.
CH471090 Genomic DNA. Translation: EAW87646.1.
CH471090 Genomic DNA. Translation: EAW87648.1.
BC019329 mRNA. Translation: AAH19329.1. Different initiation.
BC032372 mRNA. Translation: AAH32372.1.
BC033708 mRNA. Translation: AAH33708.1.
CCDSiCCDS35143.1. [Q5JS13-1]
CCDS55344.1. [Q5JS13-4]
CCDS55345.1. [Q5JS13-7]
CCDS55346.1. [Q5JS13-2]
RefSeqiNP_001177657.1. NM_001190728.1. [Q5JS13-2]
NP_001177658.1. NM_001190729.1. [Q5JS13-7]
NP_001177659.1. NM_001190730.1. [Q5JS13-4]
NP_001309249.1. NM_001322320.1. [Q5JS13-7]
NP_055451.1. NM_014636.2. [Q5JS13-1]
XP_016870836.1. XM_017015347.1. [Q5JS13-1]
XP_016870839.1. XM_017015350.1. [Q5JS13-3]
UniGeneiHs.432842.
Hs.606576.
Hs.721343.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3QXLX-ray2.24A/B23-289[»]
ProteinModelPortaliQ5JS13.
SMRiQ5JS13.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115007. 6 interactors.
IntActiQ5JS13. 3 interactors.
MINTiMINT-7968995.
STRINGi9606.ENSP00000259351.

PTM databases

iPTMnetiQ5JS13.
PhosphoSitePlusiQ5JS13.

Polymorphism and mutation databases

BioMutaiRALGPS1.
DMDMi189040074.

Proteomic databases

MaxQBiQ5JS13.
PaxDbiQ5JS13.
PeptideAtlasiQ5JS13.
PRIDEiQ5JS13.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000259351; ENSP00000259351; ENSG00000136828. [Q5JS13-1]
ENST00000373434; ENSP00000362533; ENSG00000136828. [Q5JS13-2]
ENST00000373436; ENSP00000362535; ENSG00000136828. [Q5JS13-4]
ENST00000394011; ENSP00000377579; ENSG00000136828. [Q5JS13-6]
ENST00000394022; ENSP00000377590; ENSG00000136828. [Q5JS13-3]
ENST00000424082; ENSP00000415630; ENSG00000136828. [Q5JS13-7]
GeneIDi9649.
KEGGihsa:9649.
UCSCiuc004bqo.3. human. [Q5JS13-1]

Organism-specific databases

CTDi9649.
DisGeNETi9649.
GeneCardsiRALGPS1.
HGNCiHGNC:16851. RALGPS1.
HPAiCAB002682.
MIMi614444. gene.
neXtProtiNX_Q5JS13.
OpenTargetsiENSG00000136828.
PharmGKBiPA134907502.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410KD3E. Eukaryota.
ENOG410YV9P. LUCA.
GeneTreeiENSGT00860000133664.
HOGENOMiHOG000008021.
HOVERGENiHBG059258.
InParanoidiQ5JS13.
OMAiNQVSFWL.
OrthoDBiEOG091G0NUM.
PhylomeDBiQ5JS13.
TreeFamiTF352150.

Miscellaneous databases

ChiTaRSiRALGPS1. human.
GenomeRNAii9649.
PROiQ5JS13.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000136828.
CleanExiHS_RALGPS1.
ExpressionAtlasiQ5JS13. baseline and differential.
GenevisibleiQ5JS13. HS.

Family and domain databases

CDDicd00155. RasGEF. 1 hit.
Gene3Di1.10.840.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00617. RasGEF. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00147. RasGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRGPS1_HUMAN
AccessioniPrimary (citable) accession number: Q5JS13
Secondary accession number(s): B4DR86
, E9PBQ5, O15059, Q5JT60, Q5JT65, Q5JUG5, Q8N4S6, Q8N5H4, Q8WUV7, Q9NZ16
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: February 5, 2008
Last modified: November 30, 2016
This is version 88 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.