Q5JRX3 (PREP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 83.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Presequence protease, mitochondrial Short name=hPreP EC=3.4.24.- Alternative name(s): Pitrilysin metalloproteinase 1 Short name=Metalloprotease 1 Short name=hMP1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1037 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | ATP-independent protease that degrades mitochondrial transit peptides after their cleavage. Also degrades other unstructured peptides. Specific for peptides in the range of 10 to 65 residues. Able to degrade amyloid beta A4 (APP) protein when it accumulates in mitochondrion, suggesting a link with Alzheimer disease. Shows a preference for cleavage after small polar residues and before basic residues, but without any positional preference. Ref.6 |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Enzyme regulation | Inhibited by nickel and zinc excess, and slightly activated by manganese. Ref.7 |
| Subunit structure | Homodimer By similarity. |
| Subcellular location | |
| Tissue specificity | Widely expressed. Expressed at higher level in muscle and heart compared to brain, pancreas, liver, lung and placenta. Ref.1 |
| Post-translational modification | The disulfide bond may lock the enzyme in a closed conformation under oxidized conditions, suggesting that it may participate in redox regulation of the enzyme. |
| Sequence similarities | Belongs to the peptidase M16 family. PreP subfamily. |
| Sequence caution | The sequence AAH01150.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAI39997.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transit peptide |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase Metalloprotease Protease |
| PTM | Disulfide bond |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | proteolysis Inferred from mutant phenotype Ref.6. Source: UniProtKB |
| Cellular_component | mitochondrial matrix Inferred from direct assay Ref.6. Source: UniProtKB nucleusInferred from direct assay. Source: HPA |
| Molecular_function | enzyme activator activity Traceable author statement PubMed 9733512. Source: ProtInc metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW metalloendopeptidase activityInferred from mutant phenotype Ref.6. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5JRX3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5JRX3-2) The sequence of this isoform differs from the canonical sequence as follows: 664-664: Q → QV | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q5JRX3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-53: MWRCGGRQGLCVLRRLSGGHAHHRAWRWNSNRACERALQYKLGDKIHGFTVNQ → MRNVALRRAAGPVCAEAAERR 624-689: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 15 | 15 | Mitochondrion | ||||||||
| Chain | 16 – 1037 | 1022 | Presequence protease, mitochondrial | PRO_0000249931 | |||||||
Sites | |||||||||||
| Active site | 107 | 1 | Proton acceptor | ||||||||
| Metal binding | 104 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 108 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 205 | 1 | Zinc; catalytic By similarity | ||||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 119 ↔ 556 | Probable | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 53 | 53 | MWRCG…FTVNQ → MRNVALRRAAGPVCAEAAER R in isoform 3. | VSP_046494 | |||||||
| Alternative sequence | 624 – 689 | 66 | Missing in isoform 3. | VSP_046495 | |||||||
| Alternative sequence | 664 | 1 | Q → QV in isoform 2. | VSP_020597 | |||||||
| Natural variant | 8 | 1 | Q → R. Ref.4 Corresponds to variant rs11818724 [ dbSNP | Ensembl ]. | VAR_027517 | |||||||
| Natural variant | 145 | 1 | L → V. Ref.4 Corresponds to variant rs9423502 [ dbSNP | Ensembl ]. | VAR_027518 | |||||||
| Natural variant | 169 | 1 | F → S. Ref.1 Corresponds to variant rs3814596 [ dbSNP | Ensembl ]. | VAR_027519 | |||||||
| Natural variant | 328 | 1 | I → V. Corresponds to variant rs4242746 [ dbSNP | Ensembl ]. | VAR_027520 | |||||||
| Natural variant | 397 | 1 | A → V. Corresponds to variant rs3182535 [ dbSNP | Ensembl ]. | VAR_027521 | |||||||
| Natural variant | 516 | 1 | Q → H. Corresponds to variant rs3765101 [ dbSNP | Ensembl ]. | VAR_027522 | |||||||
| Natural variant | 554 | 1 | A → D. Corresponds to variant rs12248937 [ dbSNP | Ensembl ]. | VAR_057059 | |||||||
| Natural variant | 621 | 1 | V → I. Ref.1 Corresponds to variant rs2388556 [ dbSNP | Ensembl ]. | VAR_027523 | |||||||
| Natural variant | 805 | 1 | R → Q. Corresponds to variant rs34837384 [ dbSNP | Ensembl ]. | VAR_057060 | |||||||
| Natural variant | 952 | 1 | I → M. Corresponds to variant rs2279219 [ dbSNP | Ensembl ]. | VAR_027524 | |||||||
| Natural variant | 963 | 1 | V → I. Ref.4 Corresponds to variant rs17849904 [ dbSNP | Ensembl ]. | VAR_027525 | |||||||
| Natural variant | 969 | 1 | P → L. Corresponds to variant rs2279218 [ dbSNP | Ensembl ]. | VAR_027526 | |||||||
| Natural variant | 1037 | 1 | Q → R. Corresponds to variant rs6901 [ dbSNP | Ensembl ]. | VAR_027527 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 107 | 1 | E → Q: Loss of function. Ref.6 | ||||||||
| Mutagenesis | 119 | 1 | C → S: Still active under oxidizing conditions. Ref.6 | ||||||||
| Sequence conflict | 121 | 1 | D → N in AAC67244. Ref.1 | ||||||||
| Sequence conflict | 211 | 1 | T → V in CAI40001. Ref.3 | ||||||||
| Sequence conflict | 212 | 1 | D → N in CAI40001. Ref.3 | ||||||||
| Sequence conflict | 373 | 1 | D → E in AAC67244. Ref.1 | ||||||||
| Sequence conflict | 418 – 420 | 3 | KGF → TRI in AAC67244. Ref.1 | ||||||||
| Sequence conflict | 883 – 884 | 2 | LK → FE in AAH95422. Ref.4 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, expression, and characterization of human metalloprotease 1: a novel member of the pitrilysin family of metalloendoproteases." Mzhavia N., Berman Y.L., Qian Y., Yan L., Devi L.A. DNA Cell Biol. 18:369-380(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, VARIANTS SER-169; VAL-328; VAL-397; ILE-621 AND ARG-1037. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS VAL-328; VAL-397 AND ARG-1037. Tissue: Placenta and Thymus. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ARG-8; VAL-145; VAL-328; VAL-397; ILE-963 AND ARG-1037. Tissue: Brain, Lung and Testis. |
| [5] | "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 402-1037 (ISOFORM 1), VARIANT ARG-1037. Tissue: Brain. |
| [6] | "Degradation of the amyloid beta-protein by the novel mitochondrial peptidasome, PreP." Falkevall A., Alikhani N., Bhushan S., Pavlov P.F., Busch K., Johnson K.A., Eneqvist T., Tjernberg L., Ankarcrona M., Glaser E. J. Biol. Chem. 281:29096-29104(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, DISULFIDE BOND, MUTAGENESIS OF GLU-107 AND CYS-119. |
| [7] | "Mammalian pitrilysin: substrate specificity and mitochondrial targeting." Chow K.M., Gakh O., Payne I.C., Juliano M.A., Juliano L., Isaya G., Hersh L.B. Biochemistry 48:2868-2877(2009) [PubMed] [Europe PMC] [Abstract] Cited for: TRANSIT PEPTIDE, ENZYME REGULATION, SUBSTRATE SPECIFICITY. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF061243 mRNA. Translation: AAC67244.1. AK002061 mRNA. Translation: BAG51008.1. AK303406 mRNA. Translation: BAG64460.1. AL451164 Genomic DNA. Translation: CAI40001.1. AL451164 Genomic DNA. Translation: CAI39997.1. Sequence problems. BC001150 mRNA. Translation: AAH01150.1. Different initiation. BC005025 mRNA. Translation: AAH05025.1. BC095422 mRNA. Translation: AAH95422.1. BC111987 mRNA. Translation: AAI11988.1. BC113369 mRNA. Translation: AAI13370.1. AB029027 mRNA. Translation: BAA83056.2. |
| IPI | IPI00787827. IPI00908889. IPI00952680. |
| RefSeq | NP_001229236.1. NM_001242307.1. NP_001229238.1. NM_001242309.1. NP_055704.2. NM_014889.3. |
| UniGene | Hs.528300. |
3D structure databases | |
| HSSP | HSSP built from PDB template 2FGE based on UniProtKB Q9LJL3. |
| ProteinModelPortal | Q5JRX3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5JRX3. 2 interactions. |
Protein family/group databases | |
| MEROPS | M16.009. |
PTM databases | |
| PhosphoSite | Q5JRX3. |
Polymorphism databases | |
| DMDM | 115311843. |
Proteomic databases | |
| PaxDb | Q5JRX3. |
| PRIDE | Q5JRX3. |
Protocols and materials databases | |
| DNASU | 10531. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000224949; ENSP00000224949; ENSG00000107959. ENST00000380994; ENSP00000370382; ENSG00000107959. |
| GeneID | 10531. |
| KEGG | hsa:10531. |
Organism-specific databases | |
| CTD | 10531. |
| GeneCards | GC10M003179. |
| H-InvDB | HIX0008597. |
| HGNC | HGNC:17663. PITRM1. |
| HPA | HPA006753. HPA006754. |
| neXtProt | NX_Q5JRX3. |
| PharmGKB | PA134902269. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1026. |
| HOVERGEN | HBG082167. |
| KO | K06972. |
| OrthoDB | EOG4P5K89. |
Gene expression databases | |
| ArrayExpress | Q5JRX3. |
| Bgee | Q5JRX3. |
| CleanEx | HS_PITRM1. |
| Genevestigator | Q5JRX3. |
| GermOnline | ENSG00000107959. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.830.10. 3 hits. |
| InterPro | IPR011249. Metalloenz_LuxS/M16. IPR011237. Pept_M16_dom. IPR011765. Pept_M16_N. IPR007863. Peptidase_M16_C. IPR013578. Peptidase_M16C_assoc. [Graphical view] |
| Pfam | PF08367. M16C_assoc. 1 hit. PF00675. Peptidase_M16. 1 hit. PF05193. Peptidase_M16_C. 2 hits. [Graphical view] |
| SUPFAM | SSF63411. Metalloenz_metal-bd. 4 hits. |
| PROSITE | PS00143. INSULINASE. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | PITRM1. human. |
| GenomeRNAi | 10531. |
| NextBio | 39957. |
Entry information
| Entry name | PREP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5JRX3 Secondary accession number(s): B3KMJ6 Q9UPP8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
