Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5JRA6

- MIA3_HUMAN

UniProt

Q5JRA6 - MIA3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Melanoma inhibitory activity protein 3

Gene

MIA3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Required for collagen VII (COL7A1) secretion by loading COL7A1 into transport carriers. May participate in cargo loading of COL7A1 at endoplasmic reticulum exit sites by binding to COPII coat subunits Sec23/24 and guiding SH3-bound COL7A1 into a growing carrier. Does not play a role in global protein secretion and is apparently specific to COL7A1 cargo loading. However, it may participate in secretion of other proteins in cells that do not secrete COL7A1.1 Publication

GO - Biological processi

  1. chondrocyte development Source: Ensembl
  2. collagen fibril organization Source: Ensembl
  3. exocytosis Source: UniProtKB
  4. negative regulation of cell adhesion Source: BHF-UCL
  5. negative regulation of cell migration Source: BHF-UCL
  6. positive regulation of bone mineralization Source: Ensembl
  7. positive regulation of leukocyte migration Source: BHF-UCL
  8. protein transport Source: UniProtKB
  9. wound healing Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

ER-Golgi transport, Exocytosis, Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Melanoma inhibitory activity protein 3
Alternative name(s):
C219-reactive peptide
D320
Transport and Golgi organization protein 1
Gene namesi
Name:MIA3
Synonyms:KIAA0268, TANGO, TANGO1
ORF Names:UNQ6077/PRO20088
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:24008. MIA3.

Subcellular locationi

Endoplasmic reticulum membrane 1 Publication; Single-pass type I membrane protein 1 Publication
Note: Localizes at endoplasmic reticulum exit sites. After loading of COL7A1 into transport carriers, it is not incorporated into COPII carriers and remains in the endoplasmic reticulum membrane.

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: UniProtKB
  2. integral component of membrane Source: UniProtKB
  3. membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485536.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222Sequence AnalysisAdd
BLAST
Chaini23 – 19071885Melanoma inhibitory activity protein 3PRO_0000288998Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi246 – 2461N-linked (GlcNAc...)Sequence Analysis
Glycosylationi589 – 5891N-linked (GlcNAc...)1 Publication
Modified residuei1727 – 17271PhosphoserineBy similarity
Modified residuei1741 – 17411PhosphoserineBy similarity
Modified residuei1745 – 17451Phosphoserine1 Publication
Modified residuei1892 – 18921PhosphoserineBy similarity
Modified residuei1906 – 19061Phosphoserine1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ5JRA6.
PaxDbiQ5JRA6.
PRIDEiQ5JRA6.

PTM databases

PhosphoSiteiQ5JRA6.

Miscellaneous databases

PMAP-CutDBQ5JRA6.

Expressioni

Tissue specificityi

Broadly expressed, except in bone marrow and peripheral blood mononuclear cells. Down-regulated in melanoma tissue.2 Publications

Gene expression databases

BgeeiQ5JRA6.
CleanExiHS_MIA3.
GenevestigatoriQ5JRA6.

Organism-specific databases

HPAiHPA055922.
HPA056816.

Interactioni

Subunit structurei

Interacts (via SH3 domain) with COL7A1. Associates with the COPII coat subunits Sec23/Sec24.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
COL7A1Q023882EBI-2291868,EBI-724237

Protein-protein interaction databases

BioGridi131952. 19 interactions.
IntActiQ5JRA6. 5 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ5JRA6.
SMRiQ5JRA6. Positions 33-124.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini23 – 11441122ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1166 – 117611ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1198 – 1907710CytoplasmicSequence AnalysisAdd
BLAST

Intramembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Intramembranei1145 – 116521Sequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1177 – 119721HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 10763SH3Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili471 – 53161Sequence AnalysisAdd
BLAST
Coiled coili1214 – 1396183Sequence AnalysisAdd
BLAST
Coiled coili1487 – 1639153Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1640 – 1890251Pro-richAdd
BLAST

Domaini

The proline-rich region (PRD) mediates the interaction with COPII coat subunits Sec23/24.1 Publication
Although 2 transmembrane domains are predicted, PubMed:19269366 showed that it only contains one transmembrane domain. The other predicted transmembrane region is probably a hairpin-type region embedded into the membrane, which does not cross the membrane. It is unclear which of the 2 predicted transmembrane regions is the transmembrane or the hairpin-type region.1 Publication

Sequence similaritiesi

Belongs to the MIA/OTOR family. Tango1 subfamily.Curated
Contains 1 SH3 domain.Curated

Keywords - Domaini

Coiled coil, SH3 domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG133684.
GeneTreeiENSGT00530000063635.
HOVERGENiHBG108133.
InParanoidiQ5JRA6.
OMAiDTIFSIV.
OrthoDBiEOG74TWXQ.
PhylomeDBiQ5JRA6.
TreeFamiTF333137.

Family and domain databases

InterProiIPR029781. MIA3.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23158:SF37. PTHR23158:SF37. 1 hit.
PfamiPF07653. SH3_2. 1 hit.
[Graphical view]
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5JRA6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAPGLLVW LLVLRLPWRV PGQLDPSTGR RFSEHKLCAD DECSMLMYRG
60 70 80 90 100
EALEDFTGPD CRFVNFKKGD PVYVYYKLAR GWPEVWAGSV GRTFGYFPKD
110 120 130 140 150
LIQVVHEYTK EELQVPTDET DFVCFDGGRD DFHNYNVEEL LGFLELYNSA
160 170 180 190 200
ATDSEKAVEK TLQDMEKNPE LSKEREPEPE PVEANSEESD SVFSENTEDL
210 220 230 240 250
QEQFTTQKHH SHANSQANHA QGEQASFESF EEMLQDKLKV PESENNKTSN
260 270 280 290 300
SSQVSNEQDK IDAYKLLKKE MTLDLKTKFG STADALVSDD ETTRLVTSLE
310 320 330 340 350
DDFDEELDTE YYAVGKEDEE NQEDFDELPL LTFTDGEDMK TPAKSGVEKY
360 370 380 390 400
PTDKEQNSNE EDKVQLTVPP GIKNDDKNIL TTWGDTIFSI VTGGEETRDT
410 420 430 440 450
MDLESSSSEE EKEDDDDALV PDSKQGKPQS ATDYSDPDNV DDGLFIVDIP
460 470 480 490 500
KTNNDKEVNA EHHIKGKGRG VQESKRGLVQ DKTELEDENQ EGMTVHSSVH
510 520 530 540 550
SNNLNSMPAA EKGKDTLKSA YDDTENDLKG AAIHISKGML HEEKPGEQIL
560 570 580 590 600
EGGSESESAQ KAAGNQMNDR KIQQESLGSA PLMGDDHPNA SRDSVEGDAL
610 620 630 640 650
VNGAKLHTLS VEHQREELKE ELVLKTQNQP RFSSPDEIDL PRELEDEVPI
660 670 680 690 700
LGRNLPWQQE RDVAATASKQ MSEKIRLSEG EAKEDSLDEE FFHHKAMQGT
710 720 730 740 750
EVGQTDQTDS TGGPAFLSKV EEDDYPSEEL LEDENAINAK RSKEKNPGNQ
760 770 780 790 800
GRQFDVNLQV PDRAVLGTIH PDPEIEESKQ ETSMILDSEK TSETAAKGVN
810 820 830 840 850
TGGREPNTMV EKERPLADKK AQRPFERSDF SDSIKIQTPE LGEVFQNKDS
860 870 880 890 900
DYLKNDNPEE HLKTSGLAGE PEGELSKEDH ENTEKYMGTE SQGSAAAEPE
910 920 930 940 950
DDSFHWTPHT SVEPGHSDKR EDLLIISSFF KEQQSLQRFQ KYFNVHELEA
960 970 980 990 1000
LLQEMSSKLK SAQQESLPYN MEKVLDKVFR ASESQILSIA EKMLDTRVAE
1010 1020 1030 1040 1050
NRDLGMNENN IFEEAAVLDD IQDLIYFVRY KHSTAEETAT LVMAPPLEEG
1060 1070 1080 1090 1100
LGGAMEEMQP LHEDNFSREK TAELNVQVPE EPTHLDQRVI GDTHASEVSQ
1110 1120 1130 1140 1150
KPNTEKDLDP GPVTTEDTPM DAIDANKQPE TAAEEPASVT PLENAILLIY
1160 1170 1180 1190 1200
SFMFYLTKSL VATLPDDVQP GPDFYGLPWK PVFITAFLGI ASFAIFLWRT
1210 1220 1230 1240 1250
VLVVKDRVYQ VTEQQISEKL KTIMKENTEL VQKLSNYEQK IKESKKHVQE
1260 1270 1280 1290 1300
TRKQNMILSD EAIKYKDKIK TLEKNQEILD DTAKNLRVML ESEREQNVKN
1310 1320 1330 1340 1350
QDLISENKKS IEKLKDVISM NASEFSEVQI ALNEAKLSEE KVKSECHRVQ
1360 1370 1380 1390 1400
EENARLKKKK EQLQQEIEDW SKLHAELSEQ IKSFEKSQKD LEVALTHKDD
1410 1420 1430 1440 1450
NINALTNCIT QLNLLECESE SEGQNKGGND SDELANGEVG GDRNEKMKNQ
1460 1470 1480 1490 1500
IKQMMDVSRT QTAISVVEED LKLLQLKLRA SVSTKCNLED QVKKLEDDRN
1510 1520 1530 1540 1550
SLQAAKAGLE DECKTLRQKV EILNELYQQK EMALQKKLSQ EEYERQEREH
1560 1570 1580 1590 1600
RLSAADEKAV SAAEEVKTYK RRIEEMEDEL QKTERSFKNQ IATHEKKAHE
1610 1620 1630 1640 1650
NWLKARAAER AIAEEKREAA NLRHKLLELT QKMAMLQEEP VIVKPMPGKP
1660 1670 1680 1690 1700
NTQNPPRRGP LSQNGSFGPS PVSGGECSPP LTVEPPVRPL SATLNRRDMP
1710 1720 1730 1740 1750
RSEFGSVDGP LPHPRWSAEA SGKPSPSDPG SGTATMMNSS SRGSSPTRVL
1760 1770 1780 1790 1800
DEGKVNMAPK GPPPFPGVPL MSTPMGGPVP PPIRYGPPPQ LCGPFGPRPL
1810 1820 1830 1840 1850
PPPFGPGMRP PLGLREFAPG VPPGRRDLPL HPRGFLPGHA PFRPLGSLGP
1860 1870 1880 1890 1900
REYFIPGTRL PPPTHGPQEY PPPPAVRDLL PSGSRDEPPP ASQSTSQDCS

QALKQSP
Length:1,907
Mass (Da):213,702
Last modified:February 15, 2005 - v1
Checksum:iD19C9AF1656F4B1C
GO
Isoform 2 (identifier: Q5JRA6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1304-1362: Missing.

Show »
Length:1,848
Mass (Da):206,890
Checksum:iB793E3992499E137
GO
Isoform 3 (identifier: Q5JRA6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     493-500: MTVHSSVH → FKTEPIKL
     501-1907: Missing.

Show »
Length:500
Mass (Da):56,584
Checksum:iF785E148171092E6
GO
Isoform 4 (identifier: Q5JRA6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1122: Missing.
     1123-1159: IDANKQPETAAEEPASVTPLENAILLIYSFMFYLTKS → MDSVPATVPSIAATPGDPELVGPLSVLYAAFIAKLLE

Show »
Length:785
Mass (Da):87,438
Checksum:i0A3890131D1BA2D5
GO

Sequence cautioni

The sequence BAC04810.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAF83024.1 differs from that shown. Reason: Erroneous initiation.
The sequence CAI40474.1 differs from that shown. Reason: Erroneous gene model prediction.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti46 – 461Missing in AAQ89449. (PubMed:12975309)Curated
Sequence conflicti1032 – 10321H → R in BAC04810. (PubMed:14702039)Curated
Sequence conflicti1443 – 14431R → Q in AAH47116. (PubMed:15489334)Curated
Sequence conflicti1754 – 17541K → R in BAH12416. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti482 – 4821K → E.1 Publication
Corresponds to variant rs2936053 [ dbSNP | Ensembl ].
VAR_032546
Natural varianti605 – 6051K → R.
Corresponds to variant rs2936052 [ dbSNP | Ensembl ].
VAR_032547
Natural varianti881 – 8811E → G.1 Publication
Corresponds to variant rs2936051 [ dbSNP | Ensembl ].
VAR_032548
Natural varianti1659 – 16591G → C.1 Publication
Corresponds to variant rs17857325 [ dbSNP | Ensembl ].
VAR_032549
Natural varianti1723 – 17231K → E.1 Publication
Corresponds to variant rs17854428 [ dbSNP | Ensembl ].
VAR_032550

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11221122Missing in isoform 4. 1 PublicationVSP_025860Add
BLAST
Alternative sequencei493 – 5008MTVHSSVH → FKTEPIKL in isoform 3. 1 PublicationVSP_025861
Alternative sequencei501 – 19071407Missing in isoform 3. 1 PublicationVSP_025862Add
BLAST
Alternative sequencei1123 – 115937IDANK…YLTKS → MDSVPATVPSIAATPGDPEL VGPLSVLYAAFIAKLLE in isoform 4. 1 PublicationVSP_025863Add
BLAST
Alternative sequencei1304 – 136259Missing in isoform 2. 1 PublicationVSP_025864Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY359091 mRNA. Translation: AAQ89449.1.
AK096526 mRNA. Translation: BAC04810.1. Different initiation.
AK290335 mRNA. Translation: BAF83024.1. Different initiation.
AK296712 mRNA. Translation: BAH12416.1.
AL592148 Genomic DNA. Translation: CAI40469.1.
AL592148 Genomic DNA. Translation: CAI40470.1.
AL592148 Genomic DNA. Translation: CAI40471.1.
AL592148 Genomic DNA. Translation: CAI40473.1.
AL592148 Genomic DNA. Translation: CAI40474.1. Sequence problems.
D87742 mRNA. Translation: BAA13448.1.
L34688 mRNA. Translation: AAB00324.1.
DQ166034 mRNA. Translation: AAZ95512.1.
BC047116 mRNA. Translation: AAH47116.2.
CCDSiCCDS41470.1. [Q5JRA6-1]
CCDS73035.1. [Q5JRA6-4]
RefSeqiNP_940953.2. NM_198551.3. [Q5JRA6-1]
UniGeneiHs.118474.

Genome annotation databases

EnsembliENST00000340535; ENSP00000345866; ENSG00000154305. [Q5JRA6-4]
ENST00000344507; ENSP00000341348; ENSG00000154305. [Q5JRA6-3]
ENST00000344922; ENSP00000340900; ENSG00000154305. [Q5JRA6-1]
GeneIDi375056.
KEGGihsa:375056.
UCSCiuc001hnl.3. human. [Q5JRA6-1]
uc001hnm.3. human. [Q5JRA6-4]
uc009xea.1. human. [Q5JRA6-2]

Polymorphism databases

DMDMi74741823.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY359091 mRNA. Translation: AAQ89449.1 .
AK096526 mRNA. Translation: BAC04810.1 . Different initiation.
AK290335 mRNA. Translation: BAF83024.1 . Different initiation.
AK296712 mRNA. Translation: BAH12416.1 .
AL592148 Genomic DNA. Translation: CAI40469.1 .
AL592148 Genomic DNA. Translation: CAI40470.1 .
AL592148 Genomic DNA. Translation: CAI40471.1 .
AL592148 Genomic DNA. Translation: CAI40473.1 .
AL592148 Genomic DNA. Translation: CAI40474.1 . Sequence problems.
D87742 mRNA. Translation: BAA13448.1 .
L34688 mRNA. Translation: AAB00324.1 .
DQ166034 mRNA. Translation: AAZ95512.1 .
BC047116 mRNA. Translation: AAH47116.2 .
CCDSi CCDS41470.1. [Q5JRA6-1 ]
CCDS73035.1. [Q5JRA6-4 ]
RefSeqi NP_940953.2. NM_198551.3. [Q5JRA6-1 ]
UniGenei Hs.118474.

3D structure databases

ProteinModelPortali Q5JRA6.
SMRi Q5JRA6. Positions 33-124.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 131952. 19 interactions.
IntActi Q5JRA6. 5 interactions.

PTM databases

PhosphoSitei Q5JRA6.

Polymorphism databases

DMDMi 74741823.

Proteomic databases

MaxQBi Q5JRA6.
PaxDbi Q5JRA6.
PRIDEi Q5JRA6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000340535 ; ENSP00000345866 ; ENSG00000154305 . [Q5JRA6-4 ]
ENST00000344507 ; ENSP00000341348 ; ENSG00000154305 . [Q5JRA6-3 ]
ENST00000344922 ; ENSP00000340900 ; ENSG00000154305 . [Q5JRA6-1 ]
GeneIDi 375056.
KEGGi hsa:375056.
UCSCi uc001hnl.3. human. [Q5JRA6-1 ]
uc001hnm.3. human. [Q5JRA6-4 ]
uc009xea.1. human. [Q5JRA6-2 ]

Organism-specific databases

CTDi 375056.
GeneCardsi GC01P222791.
H-InvDB HIX0001613.
HGNCi HGNC:24008. MIA3.
HPAi HPA055922.
HPA056816.
MIMi 613455. gene.
neXtProti NX_Q5JRA6.
PharmGKBi PA143485536.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG133684.
GeneTreei ENSGT00530000063635.
HOVERGENi HBG108133.
InParanoidi Q5JRA6.
OMAi DTIFSIV.
OrthoDBi EOG74TWXQ.
PhylomeDBi Q5JRA6.
TreeFami TF333137.

Miscellaneous databases

ChiTaRSi MIA3. human.
GenomeRNAii 375056.
NextBioi 100389.
PMAP-CutDB Q5JRA6.
PROi Q5JRA6.
SOURCEi Search...

Gene expression databases

Bgeei Q5JRA6.
CleanExi HS_MIA3.
Genevestigatori Q5JRA6.

Family and domain databases

InterProi IPR029781. MIA3.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view ]
PANTHERi PTHR23158:SF37. PTHR23158:SF37. 1 hit.
Pfami PF07653. SH3_2. 1 hit.
[Graphical view ]
SMARTi SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT GLU-482.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 419-1492 (ISOFORM 2).
    Tissue: Brain and Tongue.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Characterization and expression pattern of the novel MIA homolog TANGO."
    Bosserhoff A.K., Moser M., Buettner R.
    Gene Expr. Patterns 4:473-479(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-125, TISSUE SPECIFICITY.
  5. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
    Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
    DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 715-1907 (ISOFORM 1), VARIANT GLY-881.
    Tissue: Bone marrow.
  6. "Analysis of a novel cDNA encoding a C219-reactive peptide isolated from methotrexate-selected multidrug-resistant human leukemic cells."
    Norris M.D., Gilbert J., Madafiglio J., Haber M.
    Gene 156:313-314(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1306-1441.
    Tissue: Leukemia.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1441-1907 (ISOFORM 1), VARIANTS CYS-1659 AND GLU-1723.
    Tissue: Brain.
  8. "TANGO is a tumor suppressor of malignant melanoma."
    Arndt S., Bosserhoff A.K.
    Int. J. Cancer 119:2812-2820(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1906, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
    Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
    Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  11. "TANGO1 facilitates cargo loading at endoplasmic reticulum exit sites."
    Saito K., Chen M., Bard F., Chen S., Zhou H., Woodley D., Polischuk R., Schekman R., Malhotra V.
    Cell 136:891-902(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH COL7A1, TOPOLOGY, DOMAIN.
  12. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-589.
    Tissue: Liver.
  13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1745, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiMIA3_HUMAN
AccessioniPrimary (citable) accession number: Q5JRA6
Secondary accession number(s): A8K2S0
, A8MT05, A8MT13, B7Z430, Q14083, Q3S4X3, Q5JRA5, Q5JRB0, Q5JRB1, Q5JRB2, Q6UVY8, Q86Y60, Q8N8M5, Q92580
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: February 15, 2005
Last modified: October 29, 2014
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3