Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5JRA6 (MIA3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 87. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Melanoma inhibitory activity protein 3
Alternative name(s):
C219-reactive peptide
D320
Transport and Golgi organization protein 1
Gene names
Name:MIA3
Synonyms:KIAA0268, TANGO, TANGO1
ORF Names:UNQ6077/PRO20088
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1907 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Required for collagen VII (COL7A1) secretion by loading COL7A1 into transport carriers. May participate in cargo loading of COL7A1 at endoplasmic reticulum exit sites by binding to COPII coat subunits Sec23/24 and guiding SH3-bound COL7A1 into a growing carrier. Does not play a role in global protein secretion and is apparently specific to COL7A1 cargo loading. However, it may participate in secretion of other proteins in cells that do not secrete COL7A1. Ref.11

Subunit structure

Interacts (via SH3 domain) with COL7A1. Associates with the COPII coat subunits Sec23/Sec24. Ref.11

Subcellular location

Endoplasmic reticulum membrane; Single-pass type I membrane protein. Note: Localizes at endoplasmic reticulum exit sites. After loading of COL7A1 into transport carriers, it is not incorporated into COPII carriers and remains in the endoplasmic reticulum membrane. Ref.11

Tissue specificity

Broadly expressed, except in bone marrow and peripheral blood mononuclear cells. Down-regulated in melanoma tissue. Ref.4 Ref.8

Domain

The proline-rich region (PRD) mediates the interaction with COPII coat subunits Sec23/24. Ref.11

Although 2 transmembrane domains are predicted, Ref.11 showed that it only contains one transmembrane domain. The other predicted transmembrane region is probably a hairpin-type region embedded into the membrane, which does not cross the membrane. It is unclear which of the 2 predicted transmembrane regions is the transmembrane or the hairpin-type region. Ref.11

Sequence similarities

Belongs to the MIA/OTOR family. Tango1 subfamily.

Contains 1 SH3 domain.

Sequence caution

The sequence BAC04810.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAF83024.1 differs from that shown. Reason: Erroneous initiation.

The sequence CAI40474.1 differs from that shown. Reason: Erroneous gene model prediction.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

COL7A1Q023882EBI-2291868,EBI-724237

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5JRA6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5JRA6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1304-1362: Missing.
Isoform 3 (identifier: Q5JRA6-3)

The sequence of this isoform differs from the canonical sequence as follows:
     493-500: MTVHSSVH → FKTEPIKL
     501-1907: Missing.
Isoform 4 (identifier: Q5JRA6-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1122: Missing.
     1123-1159: IDANKQPETAAEEPASVTPLENAILLIYSFMFYLTKS → MDSVPATVPSIAATPGDPELVGPLSVLYAAFIAKLLE

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2222 Potential
Chain23 – 19071885Melanoma inhibitory activity protein 3
PRO_0000288998

Regions

Topological domain23 – 11441122Extracellular Potential
Intramembrane1145 – 116521 Potential
Topological domain1166 – 117611Extracellular Potential
Transmembrane1177 – 119721Helical; Potential
Topological domain1198 – 1907710Cytoplasmic Potential
Domain45 – 10763SH3
Coiled coil471 – 53161 Potential
Coiled coil1214 – 1396183 Potential
Coiled coil1487 – 1639153 Potential
Compositional bias1640 – 1890251Pro-rich

Amino acid modifications

Modified residue17271Phosphoserine By similarity
Modified residue17411Phosphoserine By similarity
Modified residue17451Phosphoserine Ref.15
Modified residue18921Phosphoserine By similarity
Modified residue19061Phosphoserine Ref.9
Glycosylation2461N-linked (GlcNAc...) Potential
Glycosylation5891N-linked (GlcNAc...) Ref.12

Natural variations

Alternative sequence1 – 11221122Missing in isoform 4.
VSP_025860
Alternative sequence493 – 5008MTVHSSVH → FKTEPIKL in isoform 3.
VSP_025861
Alternative sequence501 – 19071407Missing in isoform 3.
VSP_025862
Alternative sequence1123 – 115937IDANK…YLTKS → MDSVPATVPSIAATPGDPEL VGPLSVLYAAFIAKLLE in isoform 4.
VSP_025863
Alternative sequence1304 – 136259Missing in isoform 2.
VSP_025864
Natural variant4821K → E. Ref.1
Corresponds to variant rs2936053 [ dbSNP | Ensembl ].
VAR_032546
Natural variant6051K → R.
Corresponds to variant rs2936052 [ dbSNP | Ensembl ].
VAR_032547
Natural variant8811E → G. Ref.5
Corresponds to variant rs2936051 [ dbSNP | Ensembl ].
VAR_032548
Natural variant16591G → C. Ref.7
Corresponds to variant rs17857325 [ dbSNP | Ensembl ].
VAR_032549
Natural variant17231K → E. Ref.7
Corresponds to variant rs17854428 [ dbSNP | Ensembl ].
VAR_032550

Experimental info

Sequence conflict461Missing in AAQ89449. Ref.1
Sequence conflict10321H → R in BAC04810. Ref.2
Sequence conflict14431R → Q in AAH47116. Ref.7
Sequence conflict17541K → R in BAH12416. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 15, 2005. Version 1.
Checksum: D19C9AF1656F4B1C

FASTA1,907213,702
        10         20         30         40         50         60 
MAAAPGLLVW LLVLRLPWRV PGQLDPSTGR RFSEHKLCAD DECSMLMYRG EALEDFTGPD 

        70         80         90        100        110        120 
CRFVNFKKGD PVYVYYKLAR GWPEVWAGSV GRTFGYFPKD LIQVVHEYTK EELQVPTDET 

       130        140        150        160        170        180 
DFVCFDGGRD DFHNYNVEEL LGFLELYNSA ATDSEKAVEK TLQDMEKNPE LSKEREPEPE 

       190        200        210        220        230        240 
PVEANSEESD SVFSENTEDL QEQFTTQKHH SHANSQANHA QGEQASFESF EEMLQDKLKV 

       250        260        270        280        290        300 
PESENNKTSN SSQVSNEQDK IDAYKLLKKE MTLDLKTKFG STADALVSDD ETTRLVTSLE 

       310        320        330        340        350        360 
DDFDEELDTE YYAVGKEDEE NQEDFDELPL LTFTDGEDMK TPAKSGVEKY PTDKEQNSNE 

       370        380        390        400        410        420 
EDKVQLTVPP GIKNDDKNIL TTWGDTIFSI VTGGEETRDT MDLESSSSEE EKEDDDDALV 

       430        440        450        460        470        480 
PDSKQGKPQS ATDYSDPDNV DDGLFIVDIP KTNNDKEVNA EHHIKGKGRG VQESKRGLVQ 

       490        500        510        520        530        540 
DKTELEDENQ EGMTVHSSVH SNNLNSMPAA EKGKDTLKSA YDDTENDLKG AAIHISKGML 

       550        560        570        580        590        600 
HEEKPGEQIL EGGSESESAQ KAAGNQMNDR KIQQESLGSA PLMGDDHPNA SRDSVEGDAL 

       610        620        630        640        650        660 
VNGAKLHTLS VEHQREELKE ELVLKTQNQP RFSSPDEIDL PRELEDEVPI LGRNLPWQQE 

       670        680        690        700        710        720 
RDVAATASKQ MSEKIRLSEG EAKEDSLDEE FFHHKAMQGT EVGQTDQTDS TGGPAFLSKV 

       730        740        750        760        770        780 
EEDDYPSEEL LEDENAINAK RSKEKNPGNQ GRQFDVNLQV PDRAVLGTIH PDPEIEESKQ 

       790        800        810        820        830        840 
ETSMILDSEK TSETAAKGVN TGGREPNTMV EKERPLADKK AQRPFERSDF SDSIKIQTPE 

       850        860        870        880        890        900 
LGEVFQNKDS DYLKNDNPEE HLKTSGLAGE PEGELSKEDH ENTEKYMGTE SQGSAAAEPE 

       910        920        930        940        950        960 
DDSFHWTPHT SVEPGHSDKR EDLLIISSFF KEQQSLQRFQ KYFNVHELEA LLQEMSSKLK 

       970        980        990       1000       1010       1020 
SAQQESLPYN MEKVLDKVFR ASESQILSIA EKMLDTRVAE NRDLGMNENN IFEEAAVLDD 

      1030       1040       1050       1060       1070       1080 
IQDLIYFVRY KHSTAEETAT LVMAPPLEEG LGGAMEEMQP LHEDNFSREK TAELNVQVPE 

      1090       1100       1110       1120       1130       1140 
EPTHLDQRVI GDTHASEVSQ KPNTEKDLDP GPVTTEDTPM DAIDANKQPE TAAEEPASVT 

      1150       1160       1170       1180       1190       1200 
PLENAILLIY SFMFYLTKSL VATLPDDVQP GPDFYGLPWK PVFITAFLGI ASFAIFLWRT 

      1210       1220       1230       1240       1250       1260 
VLVVKDRVYQ VTEQQISEKL KTIMKENTEL VQKLSNYEQK IKESKKHVQE TRKQNMILSD 

      1270       1280       1290       1300       1310       1320 
EAIKYKDKIK TLEKNQEILD DTAKNLRVML ESEREQNVKN QDLISENKKS IEKLKDVISM 

      1330       1340       1350       1360       1370       1380 
NASEFSEVQI ALNEAKLSEE KVKSECHRVQ EENARLKKKK EQLQQEIEDW SKLHAELSEQ 

      1390       1400       1410       1420       1430       1440 
IKSFEKSQKD LEVALTHKDD NINALTNCIT QLNLLECESE SEGQNKGGND SDELANGEVG 

      1450       1460       1470       1480       1490       1500 
GDRNEKMKNQ IKQMMDVSRT QTAISVVEED LKLLQLKLRA SVSTKCNLED QVKKLEDDRN 

      1510       1520       1530       1540       1550       1560 
SLQAAKAGLE DECKTLRQKV EILNELYQQK EMALQKKLSQ EEYERQEREH RLSAADEKAV 

      1570       1580       1590       1600       1610       1620 
SAAEEVKTYK RRIEEMEDEL QKTERSFKNQ IATHEKKAHE NWLKARAAER AIAEEKREAA 

      1630       1640       1650       1660       1670       1680 
NLRHKLLELT QKMAMLQEEP VIVKPMPGKP NTQNPPRRGP LSQNGSFGPS PVSGGECSPP 

      1690       1700       1710       1720       1730       1740 
LTVEPPVRPL SATLNRRDMP RSEFGSVDGP LPHPRWSAEA SGKPSPSDPG SGTATMMNSS 

      1750       1760       1770       1780       1790       1800 
SRGSSPTRVL DEGKVNMAPK GPPPFPGVPL MSTPMGGPVP PPIRYGPPPQ LCGPFGPRPL 

      1810       1820       1830       1840       1850       1860 
PPPFGPGMRP PLGLREFAPG VPPGRRDLPL HPRGFLPGHA PFRPLGSLGP REYFIPGTRL 

      1870       1880       1890       1900 
PPPTHGPQEY PPPPAVRDLL PSGSRDEPPP ASQSTSQDCS QALKQSP 

« Hide

Isoform 2 [UniParc].

Checksum: B793E3992499E137
Show »

FASTA1,848206,890
Isoform 3 [UniParc].

Checksum: F785E148171092E6
Show »

FASTA50056,584
Isoform 4 [UniParc].

Checksum: 0A3890131D1BA2D5
Show »

FASTA78587,438

References

« Hide 'large scale' references
[1]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT GLU-482.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 419-1492 (ISOFORM 2).
Tissue: Brain and Tongue.
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"Characterization and expression pattern of the novel MIA homolog TANGO."
Bosserhoff A.K., Moser M., Buettner R.
Gene Expr. Patterns 4:473-479(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-125, TISSUE SPECIFICITY.
[5]"Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 715-1907 (ISOFORM 1), VARIANT GLY-881.
Tissue: Bone marrow.
[6]"Analysis of a novel cDNA encoding a C219-reactive peptide isolated from methotrexate-selected multidrug-resistant human leukemic cells."
Norris M.D., Gilbert J., Madafiglio J., Haber M.
Gene 156:313-314(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1306-1441.
Tissue: Leukemia.
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1441-1907 (ISOFORM 1), VARIANTS CYS-1659 AND GLU-1723.
Tissue: Brain.
[8]"TANGO is a tumor suppressor of malignant melanoma."
Arndt S., Bosserhoff A.K.
Int. J. Cancer 119:2812-2820(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[9]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1906, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
[11]"TANGO1 facilitates cargo loading at endoplasmic reticulum exit sites."
Saito K., Chen M., Bard F., Chen S., Zhou H., Woodley D., Polischuk R., Schekman R., Malhotra V.
Cell 136:891-902(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH COL7A1, TOPOLOGY, DOMAIN.
[12]"Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-589.
Tissue: Liver.
[13]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[14]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[15]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1745, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY359091 mRNA. Translation: AAQ89449.1.
AK096526 mRNA. Translation: BAC04810.1. Different initiation.
AK290335 mRNA. Translation: BAF83024.1. Different initiation.
AK296712 mRNA. Translation: BAH12416.1.
AL592148 Genomic DNA. Translation: CAI40469.1.
AL592148 Genomic DNA. Translation: CAI40470.1.
AL592148 Genomic DNA. Translation: CAI40471.1.
AL592148 Genomic DNA. Translation: CAI40473.1.
AL592148 Genomic DNA. Translation: CAI40474.1. Sequence problems.
D87742 mRNA. Translation: BAA13448.1.
L34688 mRNA. Translation: AAB00324.1.
DQ166034 mRNA. Translation: AAZ95512.1.
BC047116 mRNA. Translation: AAH47116.2.
RefSeqNP_940953.2. NM_198551.2.
XP_005273179.1. XM_005273122.2.
UniGeneHs.118474.

3D structure databases

ProteinModelPortalQ5JRA6.
SMRQ5JRA6. Positions 33-124.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid131952. 5 interactions.
IntActQ5JRA6. 5 interactions.

PTM databases

PhosphoSiteQ5JRA6.

Polymorphism databases

DMDM74741823.

Proteomic databases

PaxDbQ5JRA6.
PRIDEQ5JRA6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000340535; ENSP00000345866; ENSG00000154305. [Q5JRA6-4]
ENST00000344507; ENSP00000341348; ENSG00000154305. [Q5JRA6-3]
ENST00000344922; ENSP00000340900; ENSG00000154305. [Q5JRA6-1]
GeneID375056.
KEGGhsa:375056.
UCSCuc001hnl.3. human. [Q5JRA6-1]
uc001hnm.3. human. [Q5JRA6-4]
uc009xea.1. human. [Q5JRA6-2]

Organism-specific databases

CTD375056.
GeneCardsGC01P222791.
H-InvDBHIX0001613.
HGNCHGNC:24008. MIA3.
HPAHPA055922.
HPA056816.
MIM613455. gene.
neXtProtNX_Q5JRA6.
PharmGKBPA143485536.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG133684.
HOVERGENHBG108133.
InParanoidQ5JRA6.
OMADTIFSIV.
OrthoDBEOG74TWXQ.
PhylomeDBQ5JRA6.
TreeFamTF333137.

Gene expression databases

ArrayExpressQ5JRA6.
BgeeQ5JRA6.
CleanExHS_MIA3.
GenevestigatorQ5JRA6.

Family and domain databases

InterProIPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamPF07653. SH3_2. 1 hit.
[Graphical view]
SMARTSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMSSF50044. SSF50044. 1 hit.
ProtoNetSearch...

Other

ChiTaRSMIA3. human.
GenomeRNAi375056.
NextBio100389.
PMAP-CutDBQ5JRA6.
PROQ5JRA6.
SOURCESearch...

Entry information

Entry nameMIA3_HUMAN
AccessionPrimary (citable) accession number: Q5JRA6
Secondary accession number(s): A8K2S0 expand/collapse secondary AC list , A8MT05, A8MT13, B7Z430, Q14083, Q3S4X3, Q5JRA5, Q5JRB0, Q5JRB1, Q5JRB2, Q6UVY8, Q86Y60, Q8N8M5, Q92580
Entry history
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: February 15, 2005
Last modified: April 16, 2014
This is version 87 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM