Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Melanoma inhibitory activity protein 3

Gene

MIA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the transport of cargos that are too large to fit into COPII-coated vesicles and require specific mechanisms to be incorporated into membrane-bound carriers and exported from the endoplasmic reticulum. This protein is required for collagen VII (COL7A1) secretion by loading COL7A1 into transport carriers. It may participate in cargo loading of COL7A1 at endoplasmic reticulum exit sites by binding to COPII coat subunits Sec23/24 and guiding SH3-bound COL7A1 into a growing carrier. Does not play a role in global protein secretion and is apparently specific to COL7A1 cargo loading. However, it may participate in secretion of other proteins in cells that do not secrete COL7A1. It is also specifically required for the secretion of lipoproteins by participating in their export from the endoplasmic reticulum (PubMed:27138255).2 Publications

GO - Molecular functioni

  • lipoprotein transporter activity Source: UniProtKB

GO - Biological processi

  • cargo loading into COPII-coated vesicle Source: UniProtKB
  • ER to Golgi vesicle-mediated transport Source: UniProtKB
  • exocytosis Source: UniProtKB
  • lipoprotein transport Source: UniProtKB
  • negative regulation of cell adhesion Source: BHF-UCL
  • negative regulation of cell migration Source: BHF-UCL
  • positive regulation of leukocyte migration Source: BHF-UCL
  • protein transport Source: UniProtKB
  • wound healing Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

ER-Golgi transport, Exocytosis, Protein transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-5694530. Cargo concentration in the ER.

Names & Taxonomyi

Protein namesi
Recommended name:
Melanoma inhibitory activity protein 3
Alternative name(s):
C219-reactive peptide
D320
Transport and Golgi organization protein 1
Gene namesi
Name:MIA3
Synonyms:KIAA0268, TANGO, TANGO1
ORF Names:UNQ6077/PRO20088
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:24008. MIA3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini23 – 1144LumenalSequence analysisAdd BLAST1122
Intramembranei1145 – 1165Sequence analysisAdd BLAST21
Topological domaini1166 – 1176LumenalSequence analysisAdd BLAST11
Transmembranei1177 – 1197HelicalSequence analysisAdd BLAST21
Topological domaini1198 – 1907CytoplasmicSequence analysisAdd BLAST710

GO - Cellular componenti

  • endoplasmic reticulum exit site Source: UniProtKB
  • endoplasmic reticulum membrane Source: UniProtKB
  • Golgi membrane Source: GOC
  • integral component of membrane Source: UniProtKB
  • intracellular membrane-bounded organelle Source: HPA
  • membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi375056.
OpenTargetsiENSG00000154305.
PharmGKBiPA143485536.

Polymorphism and mutation databases

BioMutaiMIA3.
DMDMi74741823.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000028899823 – 1907Melanoma inhibitory activity protein 3Add BLAST1885

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei226Phosphoserine; by FAM20C1 Publication1
Modified residuei229Phosphoserine; by FAM20C1 Publication1
Glycosylationi246N-linked (GlcNAc...)Sequence analysis1
Glycosylationi589N-linked (GlcNAc...)1 Publication1
Modified residuei727PhosphoserineCombined sources1
Modified residuei876PhosphoserineCombined sources1
Modified residuei1067PhosphoserineCombined sources1
Modified residuei1431PhosphoserineBy similarity1
Modified residuei1666PhosphoserineBy similarity1
Modified residuei1678PhosphoserineBy similarity1
Modified residuei1706PhosphoserineCombined sources1
Modified residuei1727PhosphoserineBy similarity1
Modified residuei1741PhosphoserineBy similarity1
Modified residuei1745PhosphoserineCombined sources1
Modified residuei1784Asymmetric dimethylarginineBy similarity1
Modified residuei1892PhosphoserineBy similarity1
Modified residuei1906Phosphoserine; by FAM20CCombined sources1 Publication1

Keywords - PTMi

Glycoprotein, Methylation, Phosphoprotein

Proteomic databases

EPDiQ5JRA6.
MaxQBiQ5JRA6.
PaxDbiQ5JRA6.
PeptideAtlasiQ5JRA6.
PRIDEiQ5JRA6.

PTM databases

iPTMnetiQ5JRA6.
PhosphoSitePlusiQ5JRA6.

Miscellaneous databases

PMAP-CutDBQ5JRA6.

Expressioni

Tissue specificityi

Broadly expressed, except in bone marrow and peripheral blood mononuclear cells. Down-regulated in melanoma tissue.2 Publications

Gene expression databases

BgeeiENSG00000154305.
CleanExiHS_MIA3.
ExpressionAtlasiQ5JRA6. baseline and differential.
GenevisibleiQ5JRA6. HS.

Organism-specific databases

HPAiHPA055922.
HPA056816.

Interactioni

Subunit structurei

Interacts (via SH3 domain) with COL7A1. Interacts with the COPII coat subunits SEC23A and SEC24C. Interacts with CTAGE5 (PubMed:21525241). May interact with APOB and MIA2 (PubMed:27138255).3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CEP55D3DR374EBI-10244342,EBI-10173536
COL7A1Q023882EBI-2291868,EBI-724237
FXR2P511163EBI-10244342,EBI-740459
PRDM14Q9GZV83EBI-10244342,EBI-3957793
TRIM27P143733EBI-10244342,EBI-719493

Protein-protein interaction databases

BioGridi131952. 41 interactors.
IntActiQ5JRA6. 20 interactors.
STRINGi9606.ENSP00000340900.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5KYNX-ray2.55C1796-1803[»]
5KYUX-ray3.51C1796-1803[»]
5KYWX-ray3.20C1800-1808[»]
ProteinModelPortaliQ5JRA6.
SMRiQ5JRA6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini45 – 107SH3Add BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1211 – 1650Mediates interaction with CTAGE51 PublicationAdd BLAST440
Regioni1751 – 1907Proline-rich domain (PRD); mediates interaction with COPII coat subunits1 PublicationAdd BLAST157

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili471 – 531Sequence analysisAdd BLAST61
Coiled coili1214 – 1396Sequence analysisAdd BLAST183
Coiled coili1487 – 1639Sequence analysisAdd BLAST153

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1640 – 1890Pro-richAdd BLAST251

Domaini

The proline-rich domain (PRD) mediates the interaction with COPII coat subunits.1 Publication
Although 2 transmembrane domains are predicted, PubMed:19269366 showed that it only contains one transmembrane domain. The other predicted transmembrane region is probably a hairpin-type region embedded into the membrane, which does not cross the membrane. It is unclear which of the 2 predicted transmembrane regions is the transmembrane or the hairpin-type region.1 Publication

Sequence similaritiesi

Belongs to the MIA/OTOR family. Tango1 subfamily.Curated
Contains 1 SH3 domain.Curated

Keywords - Domaini

Coiled coil, SH3 domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IFUG. Eukaryota.
ENOG410YVAS. LUCA.
GeneTreeiENSGT00530000063635.
HOVERGENiHBG108133.
InParanoidiQ5JRA6.
OMAiFVRYKHS.
OrthoDBiEOG091G0PEA.
PhylomeDBiQ5JRA6.
TreeFamiTF333137.

Family and domain databases

InterProiIPR029781. MIA3.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23158:SF37. PTHR23158:SF37. 1 hit.
PfamiPF07653. SH3_2. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5JRA6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAPGLLVW LLVLRLPWRV PGQLDPSTGR RFSEHKLCAD DECSMLMYRG
60 70 80 90 100
EALEDFTGPD CRFVNFKKGD PVYVYYKLAR GWPEVWAGSV GRTFGYFPKD
110 120 130 140 150
LIQVVHEYTK EELQVPTDET DFVCFDGGRD DFHNYNVEEL LGFLELYNSA
160 170 180 190 200
ATDSEKAVEK TLQDMEKNPE LSKEREPEPE PVEANSEESD SVFSENTEDL
210 220 230 240 250
QEQFTTQKHH SHANSQANHA QGEQASFESF EEMLQDKLKV PESENNKTSN
260 270 280 290 300
SSQVSNEQDK IDAYKLLKKE MTLDLKTKFG STADALVSDD ETTRLVTSLE
310 320 330 340 350
DDFDEELDTE YYAVGKEDEE NQEDFDELPL LTFTDGEDMK TPAKSGVEKY
360 370 380 390 400
PTDKEQNSNE EDKVQLTVPP GIKNDDKNIL TTWGDTIFSI VTGGEETRDT
410 420 430 440 450
MDLESSSSEE EKEDDDDALV PDSKQGKPQS ATDYSDPDNV DDGLFIVDIP
460 470 480 490 500
KTNNDKEVNA EHHIKGKGRG VQESKRGLVQ DKTELEDENQ EGMTVHSSVH
510 520 530 540 550
SNNLNSMPAA EKGKDTLKSA YDDTENDLKG AAIHISKGML HEEKPGEQIL
560 570 580 590 600
EGGSESESAQ KAAGNQMNDR KIQQESLGSA PLMGDDHPNA SRDSVEGDAL
610 620 630 640 650
VNGAKLHTLS VEHQREELKE ELVLKTQNQP RFSSPDEIDL PRELEDEVPI
660 670 680 690 700
LGRNLPWQQE RDVAATASKQ MSEKIRLSEG EAKEDSLDEE FFHHKAMQGT
710 720 730 740 750
EVGQTDQTDS TGGPAFLSKV EEDDYPSEEL LEDENAINAK RSKEKNPGNQ
760 770 780 790 800
GRQFDVNLQV PDRAVLGTIH PDPEIEESKQ ETSMILDSEK TSETAAKGVN
810 820 830 840 850
TGGREPNTMV EKERPLADKK AQRPFERSDF SDSIKIQTPE LGEVFQNKDS
860 870 880 890 900
DYLKNDNPEE HLKTSGLAGE PEGELSKEDH ENTEKYMGTE SQGSAAAEPE
910 920 930 940 950
DDSFHWTPHT SVEPGHSDKR EDLLIISSFF KEQQSLQRFQ KYFNVHELEA
960 970 980 990 1000
LLQEMSSKLK SAQQESLPYN MEKVLDKVFR ASESQILSIA EKMLDTRVAE
1010 1020 1030 1040 1050
NRDLGMNENN IFEEAAVLDD IQDLIYFVRY KHSTAEETAT LVMAPPLEEG
1060 1070 1080 1090 1100
LGGAMEEMQP LHEDNFSREK TAELNVQVPE EPTHLDQRVI GDTHASEVSQ
1110 1120 1130 1140 1150
KPNTEKDLDP GPVTTEDTPM DAIDANKQPE TAAEEPASVT PLENAILLIY
1160 1170 1180 1190 1200
SFMFYLTKSL VATLPDDVQP GPDFYGLPWK PVFITAFLGI ASFAIFLWRT
1210 1220 1230 1240 1250
VLVVKDRVYQ VTEQQISEKL KTIMKENTEL VQKLSNYEQK IKESKKHVQE
1260 1270 1280 1290 1300
TRKQNMILSD EAIKYKDKIK TLEKNQEILD DTAKNLRVML ESEREQNVKN
1310 1320 1330 1340 1350
QDLISENKKS IEKLKDVISM NASEFSEVQI ALNEAKLSEE KVKSECHRVQ
1360 1370 1380 1390 1400
EENARLKKKK EQLQQEIEDW SKLHAELSEQ IKSFEKSQKD LEVALTHKDD
1410 1420 1430 1440 1450
NINALTNCIT QLNLLECESE SEGQNKGGND SDELANGEVG GDRNEKMKNQ
1460 1470 1480 1490 1500
IKQMMDVSRT QTAISVVEED LKLLQLKLRA SVSTKCNLED QVKKLEDDRN
1510 1520 1530 1540 1550
SLQAAKAGLE DECKTLRQKV EILNELYQQK EMALQKKLSQ EEYERQEREH
1560 1570 1580 1590 1600
RLSAADEKAV SAAEEVKTYK RRIEEMEDEL QKTERSFKNQ IATHEKKAHE
1610 1620 1630 1640 1650
NWLKARAAER AIAEEKREAA NLRHKLLELT QKMAMLQEEP VIVKPMPGKP
1660 1670 1680 1690 1700
NTQNPPRRGP LSQNGSFGPS PVSGGECSPP LTVEPPVRPL SATLNRRDMP
1710 1720 1730 1740 1750
RSEFGSVDGP LPHPRWSAEA SGKPSPSDPG SGTATMMNSS SRGSSPTRVL
1760 1770 1780 1790 1800
DEGKVNMAPK GPPPFPGVPL MSTPMGGPVP PPIRYGPPPQ LCGPFGPRPL
1810 1820 1830 1840 1850
PPPFGPGMRP PLGLREFAPG VPPGRRDLPL HPRGFLPGHA PFRPLGSLGP
1860 1870 1880 1890 1900
REYFIPGTRL PPPTHGPQEY PPPPAVRDLL PSGSRDEPPP ASQSTSQDCS

QALKQSP
Length:1,907
Mass (Da):213,702
Last modified:February 15, 2005 - v1
Checksum:iD19C9AF1656F4B1C
GO
Isoform 2 (identifier: Q5JRA6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1304-1362: Missing.

Show »
Length:1,848
Mass (Da):206,890
Checksum:iB793E3992499E137
GO
Isoform 3 (identifier: Q5JRA6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     493-500: MTVHSSVH → FKTEPIKL
     501-1907: Missing.

Show »
Length:500
Mass (Da):56,584
Checksum:iF785E148171092E6
GO
Isoform 4 (identifier: Q5JRA6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1122: Missing.
     1123-1159: IDANKQPETAAEEPASVTPLENAILLIYSFMFYLTKS → MDSVPATVPSIAATPGDPELVGPLSVLYAAFIAKLLE

Show »
Length:785
Mass (Da):87,438
Checksum:i0A3890131D1BA2D5
GO

Sequence cautioni

The sequence BAC04810 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAF83024 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAI40474 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti46Missing in AAQ89449 (PubMed:12975309).Curated1
Sequence conflicti1032H → R in BAC04810 (PubMed:14702039).Curated1
Sequence conflicti1443R → Q in AAH47116 (PubMed:15489334).Curated1
Sequence conflicti1754K → R in BAH12416 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032546482K → E.1 PublicationCorresponds to variant rs2936053dbSNPEnsembl.1
Natural variantiVAR_032547605K → R.Corresponds to variant rs2936052dbSNPEnsembl.1
Natural variantiVAR_032548881E → G.1 PublicationCorresponds to variant rs2936051dbSNPEnsembl.1
Natural variantiVAR_0325491659G → C.1 PublicationCorresponds to variant rs17857325dbSNPEnsembl.1
Natural variantiVAR_0325501723K → E.1 PublicationCorresponds to variant rs17854428dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0258601 – 1122Missing in isoform 4. 1 PublicationAdd BLAST1122
Alternative sequenceiVSP_025861493 – 500MTVHSSVH → FKTEPIKL in isoform 3. 1 Publication8
Alternative sequenceiVSP_025862501 – 1907Missing in isoform 3. 1 PublicationAdd BLAST1407
Alternative sequenceiVSP_0258631123 – 1159IDANK…YLTKS → MDSVPATVPSIAATPGDPEL VGPLSVLYAAFIAKLLE in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0258641304 – 1362Missing in isoform 2. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY359091 mRNA. Translation: AAQ89449.1.
AK096526 mRNA. Translation: BAC04810.1. Different initiation.
AK290335 mRNA. Translation: BAF83024.1. Different initiation.
AK296712 mRNA. Translation: BAH12416.1.
AL592148 Genomic DNA. Translation: CAI40469.1.
AL592148 Genomic DNA. Translation: CAI40470.1.
AL592148 Genomic DNA. Translation: CAI40471.1.
AL592148 Genomic DNA. Translation: CAI40473.1.
AL592148 Genomic DNA. Translation: CAI40474.1. Sequence problems.
D87742 mRNA. Translation: BAA13448.1.
L34688 mRNA. Translation: AAB00324.1.
DQ166034 mRNA. Translation: AAZ95512.1.
BC047116 mRNA. Translation: AAH47116.2.
CCDSiCCDS41470.1. [Q5JRA6-1]
CCDS73035.1. [Q5JRA6-4]
RefSeqiNP_001287796.1. NM_001300867.1. [Q5JRA6-4]
NP_001310992.1. NM_001324063.1. [Q5JRA6-2]
NP_940953.2. NM_198551.3. [Q5JRA6-1]
UniGeneiHs.118474.

Genome annotation databases

EnsembliENST00000340535; ENSP00000345866; ENSG00000154305. [Q5JRA6-4]
ENST00000344507; ENSP00000341348; ENSG00000154305. [Q5JRA6-3]
ENST00000344922; ENSP00000340900; ENSG00000154305. [Q5JRA6-1]
GeneIDi375056.
KEGGihsa:375056.
UCSCiuc001hnl.4. human. [Q5JRA6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY359091 mRNA. Translation: AAQ89449.1.
AK096526 mRNA. Translation: BAC04810.1. Different initiation.
AK290335 mRNA. Translation: BAF83024.1. Different initiation.
AK296712 mRNA. Translation: BAH12416.1.
AL592148 Genomic DNA. Translation: CAI40469.1.
AL592148 Genomic DNA. Translation: CAI40470.1.
AL592148 Genomic DNA. Translation: CAI40471.1.
AL592148 Genomic DNA. Translation: CAI40473.1.
AL592148 Genomic DNA. Translation: CAI40474.1. Sequence problems.
D87742 mRNA. Translation: BAA13448.1.
L34688 mRNA. Translation: AAB00324.1.
DQ166034 mRNA. Translation: AAZ95512.1.
BC047116 mRNA. Translation: AAH47116.2.
CCDSiCCDS41470.1. [Q5JRA6-1]
CCDS73035.1. [Q5JRA6-4]
RefSeqiNP_001287796.1. NM_001300867.1. [Q5JRA6-4]
NP_001310992.1. NM_001324063.1. [Q5JRA6-2]
NP_940953.2. NM_198551.3. [Q5JRA6-1]
UniGeneiHs.118474.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5KYNX-ray2.55C1796-1803[»]
5KYUX-ray3.51C1796-1803[»]
5KYWX-ray3.20C1800-1808[»]
ProteinModelPortaliQ5JRA6.
SMRiQ5JRA6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131952. 41 interactors.
IntActiQ5JRA6. 20 interactors.
STRINGi9606.ENSP00000340900.

PTM databases

iPTMnetiQ5JRA6.
PhosphoSitePlusiQ5JRA6.

Polymorphism and mutation databases

BioMutaiMIA3.
DMDMi74741823.

Proteomic databases

EPDiQ5JRA6.
MaxQBiQ5JRA6.
PaxDbiQ5JRA6.
PeptideAtlasiQ5JRA6.
PRIDEiQ5JRA6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340535; ENSP00000345866; ENSG00000154305. [Q5JRA6-4]
ENST00000344507; ENSP00000341348; ENSG00000154305. [Q5JRA6-3]
ENST00000344922; ENSP00000340900; ENSG00000154305. [Q5JRA6-1]
GeneIDi375056.
KEGGihsa:375056.
UCSCiuc001hnl.4. human. [Q5JRA6-1]

Organism-specific databases

CTDi375056.
DisGeNETi375056.
GeneCardsiMIA3.
H-InvDBHIX0001613.
HGNCiHGNC:24008. MIA3.
HPAiHPA055922.
HPA056816.
MIMi613455. gene.
neXtProtiNX_Q5JRA6.
OpenTargetsiENSG00000154305.
PharmGKBiPA143485536.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFUG. Eukaryota.
ENOG410YVAS. LUCA.
GeneTreeiENSGT00530000063635.
HOVERGENiHBG108133.
InParanoidiQ5JRA6.
OMAiFVRYKHS.
OrthoDBiEOG091G0PEA.
PhylomeDBiQ5JRA6.
TreeFamiTF333137.

Enzyme and pathway databases

ReactomeiR-HSA-5694530. Cargo concentration in the ER.

Miscellaneous databases

ChiTaRSiMIA3. human.
GenomeRNAii375056.
PMAP-CutDBQ5JRA6.
PROiQ5JRA6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000154305.
CleanExiHS_MIA3.
ExpressionAtlasiQ5JRA6. baseline and differential.
GenevisibleiQ5JRA6. HS.

Family and domain databases

InterProiIPR029781. MIA3.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23158:SF37. PTHR23158:SF37. 1 hit.
PfamiPF07653. SH3_2. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiMIA3_HUMAN
AccessioniPrimary (citable) accession number: Q5JRA6
Secondary accession number(s): A8K2S0
, A8MT05, A8MT13, B7Z430, Q14083, Q3S4X3, Q5JRA5, Q5JRB0, Q5JRB1, Q5JRB2, Q6UVY8, Q86Y60, Q8N8M5, Q92580
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: February 15, 2005
Last modified: November 30, 2016
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.