Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ER membrane protein complex subunit 4

Gene

EMC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May mediate anti-apoptotic activity.

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
ER membrane protein complex subunit 4
Alternative name(s):
Cell proliferation-inducing gene 17 protein
Transmembrane protein 85
Gene namesi
Name:EMC4
Synonyms:TMEM85
ORF Names:HSPC184, PIG17
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:28032. EMC4.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei84 – 104HelicalSequence analysisAdd BLAST21
Transmembranei130 – 150HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

  • ER membrane protein complex Source: UniProtKB
  • integral component of membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000128463.
PharmGKBiPA143485634.

Polymorphism and mutation databases

BioMutaiEMC4.
DMDMi115502869.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002519142 – 183ER membrane protein complex subunit 4Add BLAST182

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylthreonineCombined sources1
Modified residuei36PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ5J8M3.
MaxQBiQ5J8M3.
PaxDbiQ5J8M3.
PeptideAtlasiQ5J8M3.
PRIDEiQ5J8M3.
TopDownProteomicsiQ5J8M3-1. [Q5J8M3-1]
Q5J8M3-2. [Q5J8M3-2]

PTM databases

iPTMnetiQ5J8M3.
PhosphoSitePlusiQ5J8M3.

Expressioni

Tissue specificityi

Isoform 1 is expressed in brain and heart. Isoform 2 is expressed in heart.1 Publication

Gene expression databases

BgeeiENSG00000128463.
CleanExiHS_TMEM85.
ExpressionAtlasiQ5J8M3. baseline and differential.
GenevisibleiQ5J8M3. HS.

Organism-specific databases

HPAiHPA026868.
HPA053440.

Interactioni

Subunit structurei

Component of the ER membrane protein complex (EMC).1 Publication

Protein-protein interaction databases

BioGridi119397. 23 interactors.
IntActiQ5J8M3. 8 interactors.
STRINGi9606.ENSP00000267750.

Structurei

3D structure databases

ProteinModelPortaliQ5J8M3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the EMC4 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3318. Eukaryota.
ENOG41118KQ. LUCA.
GeneTreeiENSGT00390000006970.
HOGENOMiHOG000163282.
HOVERGENiHBG056123.
InParanoidiQ5J8M3.
OMAiGARRMKW.
OrthoDBiEOG091G0UKP.
PhylomeDBiQ5J8M3.
TreeFamiTF313750.

Family and domain databases

InterProiIPR009445. DUF1077_TMEM85.
[Graphical view]
PANTHERiPTHR19315. PTHR19315. 1 hit.
PfamiPF06417. DUF1077. 1 hit.
[Graphical view]
PIRSFiPIRSF017207. UCP017207_TM-p85. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5J8M3-1) [UniParc]FASTAAdd to basket
Also known as: TMEM85v1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTAQGGLVAN RGRRFKWAIE LSGPGGGSRG RSDRGSGQGD SLYPVGYLDK
60 70 80 90 100
QVPDTSVQET DRILVEKRCW DIALGPLKQI PMNLFIMYMA GNTISIFPTM
110 120 130 140 150
MVCMMAWRPI QALMAISATF KMLESSSQKF LQGLVYLIGN LMGLALAVYK
160 170 180
CQSMGLLPTH ASDWLAFIEP PERMEFSGGG LLL
Length:183
Mass (Da):20,087
Last modified:October 3, 2006 - v2
Checksum:i96888D46FF22DEDE
GO
Isoform 2 (identifier: Q5J8M3-2) [UniParc]FASTAAdd to basket
Also known as: TMEM85v2

The sequence of this isoform differs from the canonical sequence as follows:
     119-149: TFKMLESSSQKFLQGLVYLIGNLMGLALAVY → KNGVQWWRTAFVNMRKQRLVPMYLGLIYILL
     150-183: Missing.

Show »
Length:149
Mass (Da):16,745
Checksum:iD23EDF429CD88EBF
GO
Isoform 3 (identifier: Q5J8M3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-136: RCWDIALGPL...SQKFLQGLVY → VQRYRCYRSP...KNRRCLEHKV
     137-183: Missing.

Show »
Length:136
Mass (Da):15,088
Checksum:iA76B65D99C017AF7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti47Y → H in AAR24622 (Ref. 1) Curated1
Sequence conflicti129K → R in AAR24622 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05377598P → T.Corresponds to variant rs11544437dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03737468 – 136RCWDI…QGLVY → VQRYRCYRSPWASPELHTHP LLLGGVNVDSSYPEDLETKL LEAGISVFYISATKVLNNLK NRRCLEHKV in isoform 3. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_020798119 – 149TFKML…ALAVY → KNGVQWWRTAFVNMRKQRLV PMYLGLIYILL in isoform 2. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_037375137 – 183Missing in isoform 3. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_020799150 – 183Missing in isoform 2. 2 PublicationsAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY336092 mRNA. Translation: AAR24622.1.
AF151018 mRNA. Translation: AAF36104.1.
AK075227 mRNA. Translation: BAC11486.1.
AK290524 mRNA. Translation: BAF83213.1.
AK296184 mRNA. Translation: BAG58916.1.
AC079203 Genomic DNA. No translation available.
CH471125 Genomic DNA. Translation: EAW92292.1.
BC002583 mRNA. Translation: AAH02583.1.
CCDSiCCDS10035.1. [Q5J8M3-1]
CCDS66732.1. [Q5J8M3-2]
RefSeqiNP_001273349.1. NM_001286420.1. [Q5J8M3-2]
NP_057538.1. NM_016454.3. [Q5J8M3-1]
UniGeneiHs.250905.

Genome annotation databases

EnsembliENST00000249209; ENSP00000249209; ENSG00000128463. [Q5J8M3-2]
ENST00000267750; ENSP00000267750; ENSG00000128463. [Q5J8M3-1]
GeneIDi51234.
KEGGihsa:51234.
UCSCiuc001zhq.5. human. [Q5J8M3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY336092 mRNA. Translation: AAR24622.1.
AF151018 mRNA. Translation: AAF36104.1.
AK075227 mRNA. Translation: BAC11486.1.
AK290524 mRNA. Translation: BAF83213.1.
AK296184 mRNA. Translation: BAG58916.1.
AC079203 Genomic DNA. No translation available.
CH471125 Genomic DNA. Translation: EAW92292.1.
BC002583 mRNA. Translation: AAH02583.1.
CCDSiCCDS10035.1. [Q5J8M3-1]
CCDS66732.1. [Q5J8M3-2]
RefSeqiNP_001273349.1. NM_001286420.1. [Q5J8M3-2]
NP_057538.1. NM_016454.3. [Q5J8M3-1]
UniGeneiHs.250905.

3D structure databases

ProteinModelPortaliQ5J8M3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119397. 23 interactors.
IntActiQ5J8M3. 8 interactors.
STRINGi9606.ENSP00000267750.

PTM databases

iPTMnetiQ5J8M3.
PhosphoSitePlusiQ5J8M3.

Polymorphism and mutation databases

BioMutaiEMC4.
DMDMi115502869.

Proteomic databases

EPDiQ5J8M3.
MaxQBiQ5J8M3.
PaxDbiQ5J8M3.
PeptideAtlasiQ5J8M3.
PRIDEiQ5J8M3.
TopDownProteomicsiQ5J8M3-1. [Q5J8M3-1]
Q5J8M3-2. [Q5J8M3-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000249209; ENSP00000249209; ENSG00000128463. [Q5J8M3-2]
ENST00000267750; ENSP00000267750; ENSG00000128463. [Q5J8M3-1]
GeneIDi51234.
KEGGihsa:51234.
UCSCiuc001zhq.5. human. [Q5J8M3-1]

Organism-specific databases

CTDi51234.
GeneCardsiEMC4.
HGNCiHGNC:28032. EMC4.
HPAiHPA026868.
HPA053440.
MIMi616245. gene.
neXtProtiNX_Q5J8M3.
OpenTargetsiENSG00000128463.
PharmGKBiPA143485634.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3318. Eukaryota.
ENOG41118KQ. LUCA.
GeneTreeiENSGT00390000006970.
HOGENOMiHOG000163282.
HOVERGENiHBG056123.
InParanoidiQ5J8M3.
OMAiGARRMKW.
OrthoDBiEOG091G0UKP.
PhylomeDBiQ5J8M3.
TreeFamiTF313750.

Miscellaneous databases

GenomeRNAii51234.
PROiQ5J8M3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000128463.
CleanExiHS_TMEM85.
ExpressionAtlasiQ5J8M3. baseline and differential.
GenevisibleiQ5J8M3. HS.

Family and domain databases

InterProiIPR009445. DUF1077_TMEM85.
[Graphical view]
PANTHERiPTHR19315. PTHR19315. 1 hit.
PfamiPF06417. DUF1077. 1 hit.
[Graphical view]
PIRSFiPIRSF017207. UCP017207_TM-p85. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiEMC4_HUMAN
AccessioniPrimary (citable) accession number: Q5J8M3
Secondary accession number(s): A8K3A9
, B4DJQ4, Q96KX9, Q9BUI5, Q9P0T9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: October 3, 2006
Last modified: November 2, 2016
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.