Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5J8M3 (EMC4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 78. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
ER membrane protein complex subunit 4
Alternative name(s):
Cell proliferation-inducing gene 17 protein
Transmembrane protein 85
Gene names
Name:EMC4
Synonyms:TMEM85
ORF Names:HSPC184, PIG17
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length183 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May mediate anti-apoptotic activity. Ref.8

Subunit structure

Component of the ER membrane protein complex (EMC). Ref.12

Subcellular location

Membrane; Multi-pass membrane protein Ref.12.

Tissue specificity

Isoform 1 is expressed in brain and heart. Isoform 2 is expressed in heart. Ref.8

Sequence similarities

Belongs to the EMC4 family.

Ontologies

Keywords
   Biological processApoptosis
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   PTMAcetylation
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processapoptotic process

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentER membrane protein complex

Inferred from direct assay Ref.12. Source: UniProtKB

integral component of membrane

Inferred from direct assay Ref.12. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5J8M3-1)

Also known as: TMEM85v1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5J8M3-2)

Also known as: TMEM85v2;

The sequence of this isoform differs from the canonical sequence as follows:
     119-149: TFKMLESSSQKFLQGLVYLIGNLMGLALAVY → KNGVQWWRTAFVNMRKQRLVPMYLGLIYILL
     150-183: Missing.
Isoform 3 (identifier: Q5J8M3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     68-136: RCWDIALGPL...SQKFLQGLVY → VQRYRCYRSP...KNRRCLEHKV
     137-183: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed Ref.11
Chain2 – 183182ER membrane protein complex subunit 4
PRO_0000251914

Regions

Transmembrane84 – 10421Helical; Potential
Transmembrane130 – 15021Helical; Potential

Amino acid modifications

Modified residue21N-acetylthreonine Ref.11 Ref.13

Natural variations

Alternative sequence68 – 13669RCWDI…QGLVY → VQRYRCYRSPWASPELHTHP LLLGGVNVDSSYPEDLETKL LEAGISVFYISATKVLNNLK NRRCLEHKV in isoform 3.
VSP_037374
Alternative sequence119 – 14931TFKML…ALAVY → KNGVQWWRTAFVNMRKQRLV PMYLGLIYILL in isoform 2.
VSP_020798
Alternative sequence137 – 18347Missing in isoform 3.
VSP_037375
Alternative sequence150 – 18334Missing in isoform 2.
VSP_020799
Natural variant981P → T.
Corresponds to variant rs11544437 [ dbSNP | Ensembl ].
VAR_053775

Experimental info

Sequence conflict471Y → H in AAR24622. Ref.1
Sequence conflict1291K → R in AAR24622. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (TMEM85v1) [UniParc].

Last modified October 3, 2006. Version 2.
Checksum: 96888D46FF22DEDE

FASTA18320,087
        10         20         30         40         50         60 
MTAQGGLVAN RGRRFKWAIE LSGPGGGSRG RSDRGSGQGD SLYPVGYLDK QVPDTSVQET 

        70         80         90        100        110        120 
DRILVEKRCW DIALGPLKQI PMNLFIMYMA GNTISIFPTM MVCMMAWRPI QALMAISATF 

       130        140        150        160        170        180 
KMLESSSQKF LQGLVYLIGN LMGLALAVYK CQSMGLLPTH ASDWLAFIEP PERMEFSGGG 


LLL 

« Hide

Isoform 2 (TMEM85v2) [UniParc].

Checksum: D23EDF429CD88EBF
Show »

FASTA14916,745
Isoform 3 [UniParc].

Checksum: A76B65D99C017AF7
Show »

FASTA13615,088

References

« Hide 'large scale' references
[1]"Identification of a proliferation-inducing gene."
Kim J.W.
Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[2]"Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. expand/collapse author list , Gu J., Chen S.-J., Chen Z.
Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Umbilical cord blood.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
Tissue: Brain, Placenta and Thalamus.
[4]"Analysis of the DNA sequence and duplication history of human chromosome 15."
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. expand/collapse author list , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[7]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"Transmembrane protein 85 from both human (TMEM85) and yeast (YGL231c) inhibit hydrogen peroxide mediated cell death in yeast."
Ring G., Khoury C.M., Solar A.J., Yang Z., Mandato C.A., Greenwood M.T.
FEBS Lett. 582:2637-2642(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: POSSIBLE FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING.
[9]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
[12]"Defining human ERAD networks through an integrative mapping strategy."
Christianson J.C., Olzmann J.A., Shaler T.A., Sowa M.E., Bennett E.J., Richter C.M., Tyler R.E., Greenblatt E.J., Harper J.W., Kopito R.R.
Nat. Cell Biol. 14:93-105(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION IN THE EMC COMPLEX, SUBCELLULAR LOCATION.
[13]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY336092 mRNA. Translation: AAR24622.1.
AF151018 mRNA. Translation: AAF36104.1.
AK075227 mRNA. Translation: BAC11486.1.
AK290524 mRNA. Translation: BAF83213.1.
AK296184 mRNA. Translation: BAG58916.1.
AC079203 Genomic DNA. No translation available.
CH471125 Genomic DNA. Translation: EAW92292.1.
BC002583 mRNA. Translation: AAH02583.1.
RefSeqNP_001273349.1. NM_001286420.1.
NP_057538.1. NM_016454.3.
UniGeneHs.250905.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119397. 1 interaction.
IntActQ5J8M3. 1 interaction.
STRING9606.ENSP00000267750.

PTM databases

PhosphoSiteQ5J8M3.

Polymorphism databases

DMDM115502869.

Proteomic databases

PaxDbQ5J8M3.
PeptideAtlasQ5J8M3.
PRIDEQ5J8M3.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000249209; ENSP00000249209; ENSG00000128463. [Q5J8M3-2]
ENST00000267750; ENSP00000267750; ENSG00000128463. [Q5J8M3-1]
GeneID51234.
KEGGhsa:51234.
UCSCuc001zhq.3. human. [Q5J8M3-1]
uc001zhs.3. human. [Q5J8M3-2]
uc010ucb.1. human. [Q5J8M3-3]

Organism-specific databases

CTD51234.
GeneCardsGC15P034519.
HGNCHGNC:28032. EMC4.
HPAHPA053440.
neXtProtNX_Q5J8M3.
PharmGKBPA143485634.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG308755.
HOGENOMHOG000163282.
HOVERGENHBG056123.
InParanoidQ5J8M3.
OMAKSWDLAL.
OrthoDBEOG76MKBF.
PhylomeDBQ5J8M3.
TreeFamTF313750.

Gene expression databases

ArrayExpressQ5J8M3.
BgeeQ5J8M3.
CleanExHS_TMEM85.
GenevestigatorQ5J8M3.

Family and domain databases

InterProIPR009445. DUF1077_TMEM85.
[Graphical view]
PANTHERPTHR19315. PTHR19315. 1 hit.
PfamPF06417. DUF1077. 1 hit.
[Graphical view]
PIRSFPIRSF017207. UCP017207_TM-p85. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi51234.
NextBio54345.
PROQ5J8M3.

Entry information

Entry nameEMC4_HUMAN
AccessionPrimary (citable) accession number: Q5J8M3
Secondary accession number(s): A8K3A9 expand/collapse secondary AC list , B4DJQ4, Q96KX9, Q9BUI5, Q9P0T9
Entry history
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: October 3, 2006
Last modified: April 16, 2014
This is version 78 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 15

Human chromosome 15: entries, gene names and cross-references to MIM