Q5J8M3 (EMC4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 71.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: ER membrane protein complex subunit 4 Alternative name(s): Cell proliferation-inducing gene 17 protein Transmembrane protein 85 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 183 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | apoptotic process Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | ER membrane protein complex Inferred from direct assay Ref.11. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5J8M3-1) Also known as: TMEM85v1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5J8M3-2) Also known as: TMEM85v2; The sequence of this isoform differs from the canonical sequence as follows: 119-149: TFKMLESSSQKFLQGLVYLIGNLMGLALAVY → KNGVQWWRTAFVNMRKQRLVPMYLGLIYILL 150-183: Missing. | ||||||
| Isoform 3 (identifier: Q5J8M3-3) The sequence of this isoform differs from the canonical sequence as follows: 68-136: RCWDIALGPL...SQKFLQGLVY → VQRYRCYRSP...KNRRCLEHKV 137-183: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 183 | 183 | ER membrane protein complex subunit 4 | PRO_0000251914 | |||||
Regions | |||||||||
| Transmembrane | 84 – 104 | 21 | Helical; Potential | ||||||
| Transmembrane | 130 – 150 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 68 – 136 | 69 | RCWDI…QGLVY → VQRYRCYRSPWASPELHTHP LLLGGVNVDSSYPEDLETKL LEAGISVFYISATKVLNNLK NRRCLEHKV in isoform 3. | VSP_037374 | |||||
| Alternative sequence | 119 – 149 | 31 | TFKML…ALAVY → KNGVQWWRTAFVNMRKQRLV PMYLGLIYILL in isoform 2. | VSP_020798 | |||||
| Alternative sequence | 137 – 183 | 47 | Missing in isoform 3. | VSP_037375 | |||||
| Alternative sequence | 150 – 183 | 34 | Missing in isoform 2. | VSP_020799 | |||||
| Natural variant | 98 | 1 | P → T. Corresponds to variant rs11544437 [ dbSNP | Ensembl ]. | VAR_053775 | |||||
Experimental info | |||||||||
| Sequence conflict | 47 | 1 | Y → H in AAR24622. Ref.1 | ||||||
| Sequence conflict | 129 | 1 | K → R in AAR24622. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a proliferation-inducing gene." Kim J.W. Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [2] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Umbilical cord blood. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Brain, Placenta and Thalamus. |
| [4] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [8] | "Transmembrane protein 85 from both human (TMEM85) and yeast (YGL231c) inhibit hydrogen peroxide mediated cell death in yeast." Ring G., Khoury C.M., Solar A.J., Yang Z., Mandato C.A., Greenwood M.T. FEBS Lett. 582:2637-2642(2008) [PubMed] [Europe PMC] [Abstract] Cited for: POSSIBLE FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "Defining human ERAD networks through an integrative mapping strategy." Christianson J.C., Olzmann J.A., Shaler T.A., Sowa M.E., Bennett E.J., Richter C.M., Tyler R.E., Greenblatt E.J., Harper J.W., Kopito R.R. Nat. Cell Biol. 14:93-105(2012) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE EMC COMPLEX, SUBCELLULAR LOCATION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY336092 mRNA. Translation: AAR24622.1. AF151018 mRNA. Translation: AAF36104.1. AK075227 mRNA. Translation: BAC11486.1. AK290524 mRNA. Translation: BAF83213.1. AK296184 mRNA. Translation: BAG58916.1. AC079203 Genomic DNA. No translation available. CH471125 Genomic DNA. Translation: EAW92292.1. BC002583 mRNA. Translation: AAH02583.1. |
| IPI | IPI00009320. IPI00031499. IPI00791782. |
| RefSeq | NP_057538.1. NM_016454.2. |
| UniGene | Hs.250905. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5J8M3. 1 interaction. |
| STRING | 9606.ENSP00000267750. |
PTM databases | |
| PhosphoSite | Q5J8M3. |
Polymorphism databases | |
| DMDM | 115502869. |
Proteomic databases | |
| PaxDb | Q5J8M3. |
| PeptideAtlas | Q5J8M3. |
| PRIDE | Q5J8M3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000249209; ENSP00000249209; ENSG00000128463. ENST00000267750; ENSP00000267750; ENSG00000128463. |
| GeneID | 51234. |
| KEGG | hsa:51234. |
| UCSC | uc001zhq.3. human. uc001zhs.3. human. uc010ucb.1. human. |
Organism-specific databases | |
| CTD | 51234. |
| GeneCards | GC15P034519. |
| HGNC | HGNC:28032. EMC4. |
| HPA | HPA053440. |
| neXtProt | NX_Q5J8M3. |
| PharmGKB | PA143485634. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG308755. |
| HOGENOM | HOG000163282. |
| HOVERGEN | HBG056123. |
| InParanoid | Q5J8M3. |
| OMA | KSWDLAL. |
| OrthoDB | EOG405S2H. |
| PhylomeDB | Q5J8M3. |
Gene expression databases | |
| ArrayExpress | Q5J8M3. |
| Bgee | Q5J8M3. |
| CleanEx | HS_TMEM85. |
| Genevestigator | Q5J8M3. |
| GermOnline | ENSG00000128463. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR009445. DUF1077_TMEM85. [Graphical view] |
| PANTHER | PTHR19315. PTHR19315. 1 hit. |
| Pfam | PF06417. DUF1077. 1 hit. [Graphical view] |
| PIRSF | PIRSF017207. UCP017207_TM-p85. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 51234. |
| NextBio | 54345. |
Entry information
| Entry name | EMC4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5J8M3 Secondary accession number(s): A8K3A9 Q9P0T9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
