Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ER membrane protein complex subunit 4

Gene

EMC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May mediate anti-apoptotic activity.

GO - Biological processi

Keywordsi

Biological processApoptosis

Protein family/group databases

TCDBi3.A.27.1.1 the c-terminal tail-anchored membrane protein biogenesis/ insertion complex-2 (tamp-b2) family

Names & Taxonomyi

Protein namesi
Recommended name:
ER membrane protein complex subunit 4
Alternative name(s):
Cell proliferation-inducing gene 17 protein
Transmembrane protein 85
Gene namesi
Name:EMC4
Synonyms:TMEM85
ORF Names:HSPC184, PIG17
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000128463.12
HGNCiHGNC:28032 EMC4
MIMi616245 gene
neXtProtiNX_Q5J8M3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei84 – 104HelicalSequence analysisAdd BLAST21
Transmembranei130 – 150HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000128463
PharmGKBiPA143485634

Polymorphism and mutation databases

BioMutaiEMC4
DMDMi115502869

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00002519142 – 183ER membrane protein complex subunit 4Add BLAST182

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylthreonineCombined sources1 Publication1
Modified residuei36PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ5J8M3
MaxQBiQ5J8M3
PaxDbiQ5J8M3
PeptideAtlasiQ5J8M3
PRIDEiQ5J8M3
TopDownProteomicsiQ5J8M3-1 [Q5J8M3-1]
Q5J8M3-2 [Q5J8M3-2]

PTM databases

iPTMnetiQ5J8M3
PhosphoSitePlusiQ5J8M3

Expressioni

Tissue specificityi

Isoform 1 is expressed in brain and heart. Isoform 2 is expressed in heart.1 Publication

Gene expression databases

BgeeiENSG00000128463
CleanExiHS_TMEM85
ExpressionAtlasiQ5J8M3 baseline and differential
GenevisibleiQ5J8M3 HS

Organism-specific databases

HPAiHPA026868
HPA053440

Interactioni

Subunit structurei

Component of the ER membrane protein complex (EMC).1 Publication

Protein-protein interaction databases

BioGridi119397, 29 interactors
IntActiQ5J8M3, 10 interactors
STRINGi9606.ENSP00000267750

Family & Domainsi

Sequence similaritiesi

Belongs to the EMC4 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3318 Eukaryota
ENOG41118KQ LUCA
GeneTreeiENSGT00390000006970
HOGENOMiHOG000163282
HOVERGENiHBG056123
InParanoidiQ5J8M3
OMAiPMTAIMM
OrthoDBiEOG091G0UKP
PhylomeDBiQ5J8M3
TreeFamiTF313750

Family and domain databases

InterProiView protein in InterPro
IPR009445 TMEM85/Emc4
PANTHERiPTHR19315 PTHR19315, 1 hit
PfamiView protein in Pfam
PF06417 DUF1077, 1 hit
PIRSFiPIRSF017207 UCP017207_TM-p85, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5J8M3-1) [UniParc]FASTAAdd to basket
Also known as: TMEM85v1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTAQGGLVAN RGRRFKWAIE LSGPGGGSRG RSDRGSGQGD SLYPVGYLDK
60 70 80 90 100
QVPDTSVQET DRILVEKRCW DIALGPLKQI PMNLFIMYMA GNTISIFPTM
110 120 130 140 150
MVCMMAWRPI QALMAISATF KMLESSSQKF LQGLVYLIGN LMGLALAVYK
160 170 180
CQSMGLLPTH ASDWLAFIEP PERMEFSGGG LLL
Length:183
Mass (Da):20,087
Last modified:October 3, 2006 - v2
Checksum:i96888D46FF22DEDE
GO
Isoform 2 (identifier: Q5J8M3-2) [UniParc]FASTAAdd to basket
Also known as: TMEM85v2

The sequence of this isoform differs from the canonical sequence as follows:
     119-149: TFKMLESSSQKFLQGLVYLIGNLMGLALAVY → KNGVQWWRTAFVNMRKQRLVPMYLGLIYILL
     150-183: Missing.

Show »
Length:149
Mass (Da):16,745
Checksum:iD23EDF429CD88EBF
GO
Isoform 3 (identifier: Q5J8M3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-136: RCWDIALGPL...SQKFLQGLVY → VQRYRCYRSP...KNRRCLEHKV
     137-183: Missing.

Show »
Length:136
Mass (Da):15,088
Checksum:iA76B65D99C017AF7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti47Y → H in AAR24622 (Ref. 1) Curated1
Sequence conflicti129K → R in AAR24622 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05377598P → T. Corresponds to variant dbSNP:rs11544437Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03737468 – 136RCWDI…QGLVY → VQRYRCYRSPWASPELHTHP LLLGGVNVDSSYPEDLETKL LEAGISVFYISATKVLNNLK NRRCLEHKV in isoform 3. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_020798119 – 149TFKML…ALAVY → KNGVQWWRTAFVNMRKQRLV PMYLGLIYILL in isoform 2. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_037375137 – 183Missing in isoform 3. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_020799150 – 183Missing in isoform 2. 2 PublicationsAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY336092 mRNA Translation: AAR24622.1
AF151018 mRNA Translation: AAF36104.1
AK075227 mRNA Translation: BAC11486.1
AK290524 mRNA Translation: BAF83213.1
AK296184 mRNA Translation: BAG58916.1
AC079203 Genomic DNA No translation available.
CH471125 Genomic DNA Translation: EAW92292.1
BC002583 mRNA Translation: AAH02583.1
CCDSiCCDS10035.1 [Q5J8M3-1]
CCDS66732.1 [Q5J8M3-2]
RefSeqiNP_001273349.1, NM_001286420.1 [Q5J8M3-2]
NP_057538.1, NM_016454.3 [Q5J8M3-1]
UniGeneiHs.250905

Genome annotation databases

EnsembliENST00000249209; ENSP00000249209; ENSG00000128463 [Q5J8M3-2]
ENST00000267750; ENSP00000267750; ENSG00000128463 [Q5J8M3-1]
GeneIDi51234
KEGGihsa:51234
UCSCiuc001zhq.5 human [Q5J8M3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiEMC4_HUMAN
AccessioniPrimary (citable) accession number: Q5J8M3
Secondary accession number(s): A8K3A9
, B4DJQ4, Q96KX9, Q9BUI5, Q9P0T9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: October 3, 2006
Last modified: May 23, 2018
This is version 108 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health