Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5J8M3

- EMC4_HUMAN

UniProt

Q5J8M3 - EMC4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

ER membrane protein complex subunit 4

Gene

EMC4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May mediate anti-apoptotic activity.

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
ER membrane protein complex subunit 4
Alternative name(s):
Cell proliferation-inducing gene 17 protein
Transmembrane protein 85
Gene namesi
Name:EMC4
Synonyms:TMEM85
ORF Names:HSPC184, PIG17
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:28032. EMC4.

Subcellular locationi

Membrane 1 Publication; Multi-pass membrane protein 1 Publication

GO - Cellular componenti

  1. ER membrane protein complex Source: UniProtKB
  2. integral component of membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485634.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed2 Publications
Chaini2 – 183182ER membrane protein complex subunit 4PRO_0000251914Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylthreonine2 Publications

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ5J8M3.
PaxDbiQ5J8M3.
PeptideAtlasiQ5J8M3.
PRIDEiQ5J8M3.

PTM databases

PhosphoSiteiQ5J8M3.

Expressioni

Tissue specificityi

Isoform 1 is expressed in brain and heart. Isoform 2 is expressed in heart.1 Publication

Gene expression databases

BgeeiQ5J8M3.
CleanExiHS_TMEM85.
ExpressionAtlasiQ5J8M3. baseline and differential.
GenevestigatoriQ5J8M3.

Organism-specific databases

HPAiHPA053440.

Interactioni

Subunit structurei

Component of the ER membrane protein complex (EMC).1 Publication

Protein-protein interaction databases

BioGridi119397. 2 interactions.
IntActiQ5J8M3. 1 interaction.
STRINGi9606.ENSP00000267750.

Structurei

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei84 – 10421HelicalSequence AnalysisAdd
BLAST
Transmembranei130 – 15021HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the EMC4 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG308755.
GeneTreeiENSGT00390000006970.
HOGENOMiHOG000163282.
HOVERGENiHBG056123.
InParanoidiQ5J8M3.
OMAiKSWDLAL.
OrthoDBiEOG76MKBF.
PhylomeDBiQ5J8M3.
TreeFamiTF313750.

Family and domain databases

InterProiIPR009445. DUF1077_TMEM85.
[Graphical view]
PANTHERiPTHR19315. PTHR19315. 1 hit.
PfamiPF06417. DUF1077. 1 hit.
[Graphical view]
PIRSFiPIRSF017207. UCP017207_TM-p85. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5J8M3-1) [UniParc]FASTAAdd to Basket

Also known as: TMEM85v1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTAQGGLVAN RGRRFKWAIE LSGPGGGSRG RSDRGSGQGD SLYPVGYLDK
60 70 80 90 100
QVPDTSVQET DRILVEKRCW DIALGPLKQI PMNLFIMYMA GNTISIFPTM
110 120 130 140 150
MVCMMAWRPI QALMAISATF KMLESSSQKF LQGLVYLIGN LMGLALAVYK
160 170 180
CQSMGLLPTH ASDWLAFIEP PERMEFSGGG LLL
Length:183
Mass (Da):20,087
Last modified:October 3, 2006 - v2
Checksum:i96888D46FF22DEDE
GO
Isoform 2 (identifier: Q5J8M3-2) [UniParc]FASTAAdd to Basket

Also known as: TMEM85v2

The sequence of this isoform differs from the canonical sequence as follows:
     119-149: TFKMLESSSQKFLQGLVYLIGNLMGLALAVY → KNGVQWWRTAFVNMRKQRLVPMYLGLIYILL
     150-183: Missing.

Show »
Length:149
Mass (Da):16,745
Checksum:iD23EDF429CD88EBF
GO
Isoform 3 (identifier: Q5J8M3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-136: RCWDIALGPL...SQKFLQGLVY → VQRYRCYRSP...KNRRCLEHKV
     137-183: Missing.

Show »
Length:136
Mass (Da):15,088
Checksum:iA76B65D99C017AF7
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti47 – 471Y → H in AAR24622. 1 PublicationCurated
Sequence conflicti129 – 1291K → R in AAR24622. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti98 – 981P → T.
Corresponds to variant rs11544437 [ dbSNP | Ensembl ].
VAR_053775

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei68 – 13669RCWDI…QGLVY → VQRYRCYRSPWASPELHTHP LLLGGVNVDSSYPEDLETKL LEAGISVFYISATKVLNNLK NRRCLEHKV in isoform 3. 1 PublicationVSP_037374Add
BLAST
Alternative sequencei119 – 14931TFKML…ALAVY → KNGVQWWRTAFVNMRKQRLV PMYLGLIYILL in isoform 2. 2 PublicationsVSP_020798Add
BLAST
Alternative sequencei137 – 18347Missing in isoform 3. 1 PublicationVSP_037375Add
BLAST
Alternative sequencei150 – 18334Missing in isoform 2. 2 PublicationsVSP_020799Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY336092 mRNA. Translation: AAR24622.1.
AF151018 mRNA. Translation: AAF36104.1.
AK075227 mRNA. Translation: BAC11486.1.
AK290524 mRNA. Translation: BAF83213.1.
AK296184 mRNA. Translation: BAG58916.1.
AC079203 Genomic DNA. No translation available.
CH471125 Genomic DNA. Translation: EAW92292.1.
BC002583 mRNA. Translation: AAH02583.1.
CCDSiCCDS10035.1. [Q5J8M3-1]
CCDS66732.1. [Q5J8M3-2]
RefSeqiNP_001273349.1. NM_001286420.1. [Q5J8M3-2]
NP_057538.1. NM_016454.3. [Q5J8M3-1]
UniGeneiHs.250905.

Genome annotation databases

EnsembliENST00000249209; ENSP00000249209; ENSG00000128463. [Q5J8M3-2]
ENST00000267750; ENSP00000267750; ENSG00000128463. [Q5J8M3-1]
GeneIDi51234.
KEGGihsa:51234.
UCSCiuc001zhq.3. human. [Q5J8M3-1]
uc001zhs.3. human. [Q5J8M3-2]
uc010ucb.1. human. [Q5J8M3-3]

Polymorphism databases

DMDMi115502869.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY336092 mRNA. Translation: AAR24622.1 .
AF151018 mRNA. Translation: AAF36104.1 .
AK075227 mRNA. Translation: BAC11486.1 .
AK290524 mRNA. Translation: BAF83213.1 .
AK296184 mRNA. Translation: BAG58916.1 .
AC079203 Genomic DNA. No translation available.
CH471125 Genomic DNA. Translation: EAW92292.1 .
BC002583 mRNA. Translation: AAH02583.1 .
CCDSi CCDS10035.1. [Q5J8M3-1 ]
CCDS66732.1. [Q5J8M3-2 ]
RefSeqi NP_001273349.1. NM_001286420.1. [Q5J8M3-2 ]
NP_057538.1. NM_016454.3. [Q5J8M3-1 ]
UniGenei Hs.250905.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119397. 2 interactions.
IntActi Q5J8M3. 1 interaction.
STRINGi 9606.ENSP00000267750.

PTM databases

PhosphoSitei Q5J8M3.

Polymorphism databases

DMDMi 115502869.

Proteomic databases

MaxQBi Q5J8M3.
PaxDbi Q5J8M3.
PeptideAtlasi Q5J8M3.
PRIDEi Q5J8M3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000249209 ; ENSP00000249209 ; ENSG00000128463 . [Q5J8M3-2 ]
ENST00000267750 ; ENSP00000267750 ; ENSG00000128463 . [Q5J8M3-1 ]
GeneIDi 51234.
KEGGi hsa:51234.
UCSCi uc001zhq.3. human. [Q5J8M3-1 ]
uc001zhs.3. human. [Q5J8M3-2 ]
uc010ucb.1. human. [Q5J8M3-3 ]

Organism-specific databases

CTDi 51234.
GeneCardsi GC15P034519.
HGNCi HGNC:28032. EMC4.
HPAi HPA053440.
neXtProti NX_Q5J8M3.
PharmGKBi PA143485634.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG308755.
GeneTreei ENSGT00390000006970.
HOGENOMi HOG000163282.
HOVERGENi HBG056123.
InParanoidi Q5J8M3.
OMAi KSWDLAL.
OrthoDBi EOG76MKBF.
PhylomeDBi Q5J8M3.
TreeFami TF313750.

Miscellaneous databases

GenomeRNAii 51234.
NextBioi 54345.
PROi Q5J8M3.

Gene expression databases

Bgeei Q5J8M3.
CleanExi HS_TMEM85.
ExpressionAtlasi Q5J8M3. baseline and differential.
Genevestigatori Q5J8M3.

Family and domain databases

InterProi IPR009445. DUF1077_TMEM85.
[Graphical view ]
PANTHERi PTHR19315. PTHR19315. 1 hit.
Pfami PF06417. DUF1077. 1 hit.
[Graphical view ]
PIRSFi PIRSF017207. UCP017207_TM-p85. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a proliferation-inducing gene."
    Kim J.W.
    Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Umbilical cord blood.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Brain, Placenta and Thalamus.
  4. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Transmembrane protein 85 from both human (TMEM85) and yeast (YGL231c) inhibit hydrogen peroxide mediated cell death in yeast."
    Ring G., Khoury C.M., Solar A.J., Yang Z., Mandato C.A., Greenwood M.T.
    FEBS Lett. 582:2637-2642(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: POSSIBLE FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  12. Cited for: IDENTIFICATION IN THE EMC COMPLEX, SUBCELLULAR LOCATION.
  13. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiEMC4_HUMAN
AccessioniPrimary (citable) accession number: Q5J8M3
Secondary accession number(s): A8K3A9
, B4DJQ4, Q96KX9, Q9BUI5, Q9P0T9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: October 3, 2006
Last modified: October 29, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3