Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5J8M3

- EMC4_HUMAN

UniProt

Q5J8M3 - EMC4_HUMAN

Protein

ER membrane protein complex subunit 4

Gene

EMC4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 81 (01 Oct 2014)
      Sequence version 2 (03 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May mediate anti-apoptotic activity.

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW

    Keywords - Biological processi

    Apoptosis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    ER membrane protein complex subunit 4
    Alternative name(s):
    Cell proliferation-inducing gene 17 protein
    Transmembrane protein 85
    Gene namesi
    Name:EMC4
    Synonyms:TMEM85
    ORF Names:HSPC184, PIG17
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:28032. EMC4.

    Subcellular locationi

    Membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. ER membrane protein complex Source: UniProtKB
    2. integral component of membrane Source: UniProtKB

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA143485634.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed2 Publications
    Chaini2 – 183182ER membrane protein complex subunit 4PRO_0000251914Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylthreonine2 Publications

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ5J8M3.
    PaxDbiQ5J8M3.
    PeptideAtlasiQ5J8M3.
    PRIDEiQ5J8M3.

    PTM databases

    PhosphoSiteiQ5J8M3.

    Expressioni

    Tissue specificityi

    Isoform 1 is expressed in brain and heart. Isoform 2 is expressed in heart.1 Publication

    Gene expression databases

    ArrayExpressiQ5J8M3.
    BgeeiQ5J8M3.
    CleanExiHS_TMEM85.
    GenevestigatoriQ5J8M3.

    Organism-specific databases

    HPAiHPA053440.

    Interactioni

    Subunit structurei

    Component of the ER membrane protein complex (EMC).1 Publication

    Protein-protein interaction databases

    BioGridi119397. 1 interaction.
    IntActiQ5J8M3. 1 interaction.
    STRINGi9606.ENSP00000267750.

    Structurei

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei84 – 10421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei130 – 15021HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the EMC4 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG308755.
    HOGENOMiHOG000163282.
    HOVERGENiHBG056123.
    InParanoidiQ5J8M3.
    OMAiKSWDLAL.
    OrthoDBiEOG76MKBF.
    PhylomeDBiQ5J8M3.
    TreeFamiTF313750.

    Family and domain databases

    InterProiIPR009445. DUF1077_TMEM85.
    [Graphical view]
    PANTHERiPTHR19315. PTHR19315. 1 hit.
    PfamiPF06417. DUF1077. 1 hit.
    [Graphical view]
    PIRSFiPIRSF017207. UCP017207_TM-p85. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5J8M3-1) [UniParc]FASTAAdd to Basket

    Also known as: TMEM85v1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTAQGGLVAN RGRRFKWAIE LSGPGGGSRG RSDRGSGQGD SLYPVGYLDK    50
    QVPDTSVQET DRILVEKRCW DIALGPLKQI PMNLFIMYMA GNTISIFPTM 100
    MVCMMAWRPI QALMAISATF KMLESSSQKF LQGLVYLIGN LMGLALAVYK 150
    CQSMGLLPTH ASDWLAFIEP PERMEFSGGG LLL 183
    Length:183
    Mass (Da):20,087
    Last modified:October 3, 2006 - v2
    Checksum:i96888D46FF22DEDE
    GO
    Isoform 2 (identifier: Q5J8M3-2) [UniParc]FASTAAdd to Basket

    Also known as: TMEM85v2

    The sequence of this isoform differs from the canonical sequence as follows:
         119-149: TFKMLESSSQKFLQGLVYLIGNLMGLALAVY → KNGVQWWRTAFVNMRKQRLVPMYLGLIYILL
         150-183: Missing.

    Show »
    Length:149
    Mass (Da):16,745
    Checksum:iD23EDF429CD88EBF
    GO
    Isoform 3 (identifier: Q5J8M3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         68-136: RCWDIALGPL...SQKFLQGLVY → VQRYRCYRSP...KNRRCLEHKV
         137-183: Missing.

    Show »
    Length:136
    Mass (Da):15,088
    Checksum:iA76B65D99C017AF7
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti47 – 471Y → H in AAR24622. 1 PublicationCurated
    Sequence conflicti129 – 1291K → R in AAR24622. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti98 – 981P → T.
    Corresponds to variant rs11544437 [ dbSNP | Ensembl ].
    VAR_053775

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei68 – 13669RCWDI…QGLVY → VQRYRCYRSPWASPELHTHP LLLGGVNVDSSYPEDLETKL LEAGISVFYISATKVLNNLK NRRCLEHKV in isoform 3. 1 PublicationVSP_037374Add
    BLAST
    Alternative sequencei119 – 14931TFKML…ALAVY → KNGVQWWRTAFVNMRKQRLV PMYLGLIYILL in isoform 2. 2 PublicationsVSP_020798Add
    BLAST
    Alternative sequencei137 – 18347Missing in isoform 3. 1 PublicationVSP_037375Add
    BLAST
    Alternative sequencei150 – 18334Missing in isoform 2. 2 PublicationsVSP_020799Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY336092 mRNA. Translation: AAR24622.1.
    AF151018 mRNA. Translation: AAF36104.1.
    AK075227 mRNA. Translation: BAC11486.1.
    AK290524 mRNA. Translation: BAF83213.1.
    AK296184 mRNA. Translation: BAG58916.1.
    AC079203 Genomic DNA. No translation available.
    CH471125 Genomic DNA. Translation: EAW92292.1.
    BC002583 mRNA. Translation: AAH02583.1.
    CCDSiCCDS10035.1. [Q5J8M3-1]
    CCDS66732.1. [Q5J8M3-2]
    RefSeqiNP_001273349.1. NM_001286420.1. [Q5J8M3-2]
    NP_057538.1. NM_016454.3. [Q5J8M3-1]
    UniGeneiHs.250905.

    Genome annotation databases

    EnsembliENST00000249209; ENSP00000249209; ENSG00000128463. [Q5J8M3-2]
    ENST00000267750; ENSP00000267750; ENSG00000128463. [Q5J8M3-1]
    GeneIDi51234.
    KEGGihsa:51234.
    UCSCiuc001zhq.3. human. [Q5J8M3-1]
    uc001zhs.3. human. [Q5J8M3-2]
    uc010ucb.1. human. [Q5J8M3-3]

    Polymorphism databases

    DMDMi115502869.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY336092 mRNA. Translation: AAR24622.1 .
    AF151018 mRNA. Translation: AAF36104.1 .
    AK075227 mRNA. Translation: BAC11486.1 .
    AK290524 mRNA. Translation: BAF83213.1 .
    AK296184 mRNA. Translation: BAG58916.1 .
    AC079203 Genomic DNA. No translation available.
    CH471125 Genomic DNA. Translation: EAW92292.1 .
    BC002583 mRNA. Translation: AAH02583.1 .
    CCDSi CCDS10035.1. [Q5J8M3-1 ]
    CCDS66732.1. [Q5J8M3-2 ]
    RefSeqi NP_001273349.1. NM_001286420.1. [Q5J8M3-2 ]
    NP_057538.1. NM_016454.3. [Q5J8M3-1 ]
    UniGenei Hs.250905.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119397. 1 interaction.
    IntActi Q5J8M3. 1 interaction.
    STRINGi 9606.ENSP00000267750.

    PTM databases

    PhosphoSitei Q5J8M3.

    Polymorphism databases

    DMDMi 115502869.

    Proteomic databases

    MaxQBi Q5J8M3.
    PaxDbi Q5J8M3.
    PeptideAtlasi Q5J8M3.
    PRIDEi Q5J8M3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000249209 ; ENSP00000249209 ; ENSG00000128463 . [Q5J8M3-2 ]
    ENST00000267750 ; ENSP00000267750 ; ENSG00000128463 . [Q5J8M3-1 ]
    GeneIDi 51234.
    KEGGi hsa:51234.
    UCSCi uc001zhq.3. human. [Q5J8M3-1 ]
    uc001zhs.3. human. [Q5J8M3-2 ]
    uc010ucb.1. human. [Q5J8M3-3 ]

    Organism-specific databases

    CTDi 51234.
    GeneCardsi GC15P034519.
    HGNCi HGNC:28032. EMC4.
    HPAi HPA053440.
    neXtProti NX_Q5J8M3.
    PharmGKBi PA143485634.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG308755.
    HOGENOMi HOG000163282.
    HOVERGENi HBG056123.
    InParanoidi Q5J8M3.
    OMAi KSWDLAL.
    OrthoDBi EOG76MKBF.
    PhylomeDBi Q5J8M3.
    TreeFami TF313750.

    Miscellaneous databases

    GenomeRNAii 51234.
    NextBioi 54345.
    PROi Q5J8M3.

    Gene expression databases

    ArrayExpressi Q5J8M3.
    Bgeei Q5J8M3.
    CleanExi HS_TMEM85.
    Genevestigatori Q5J8M3.

    Family and domain databases

    InterProi IPR009445. DUF1077_TMEM85.
    [Graphical view ]
    PANTHERi PTHR19315. PTHR19315. 1 hit.
    Pfami PF06417. DUF1077. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF017207. UCP017207_TM-p85. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a proliferation-inducing gene."
      Kim J.W.
      Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    2. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
      Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
      , Gu J., Chen S.-J., Chen Z.
      Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Umbilical cord blood.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: Brain, Placenta and Thalamus.
    4. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Transmembrane protein 85 from both human (TMEM85) and yeast (YGL231c) inhibit hydrogen peroxide mediated cell death in yeast."
      Ring G., Khoury C.M., Solar A.J., Yang Z., Mandato C.A., Greenwood M.T.
      FEBS Lett. 582:2637-2642(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: POSSIBLE FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    12. Cited for: IDENTIFICATION IN THE EMC COMPLEX, SUBCELLULAR LOCATION.
    13. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiEMC4_HUMAN
    AccessioniPrimary (citable) accession number: Q5J8M3
    Secondary accession number(s): A8K3A9
    , B4DJQ4, Q96KX9, Q9BUI5, Q9P0T9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 3, 2006
    Last sequence update: October 3, 2006
    Last modified: October 1, 2014
    This is version 81 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3