Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc transporter 9

Gene

Slc30a9

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the p160 coactivator signaling pathway that mediates transcriptional activation by nuclear receptors. Plays a role in transcriptional activation of Wnt-responsive genes.2 Publications

GO - Molecular functioni

  • cation transmembrane transporter activity Source: InterPro
  • chromatin binding Source: MGI
  • ligand-dependent nuclear receptor binding Source: MGI
  • ligand-dependent nuclear receptor transcription coactivator activity Source: MGI

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ion transport, Transcription, Transcription regulation, Transport, Zinc transport

Keywords - Ligandi

Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc transporter 9
Short name:
ZnT-9
Alternative name(s):
GRIP1-associated coactivator 63
Short name:
GAC63
Solute carrier family 30 member 9
Gene namesi
Name:Slc30a9
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1923690. Slc30a9.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei238 – 25821HelicalSequence analysisAdd
BLAST
Transmembranei313 – 33321HelicalSequence analysisAdd
BLAST
Transmembranei341 – 36121HelicalSequence analysisAdd
BLAST
Transmembranei391 – 41121HelicalSequence analysisAdd
BLAST
Transmembranei423 – 44321HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 567567Zinc transporter 9PRO_0000295806Add
BLAST

Proteomic databases

EPDiQ5IRJ6.
MaxQBiQ5IRJ6.
PaxDbiQ5IRJ6.
PRIDEiQ5IRJ6.

PTM databases

iPTMnetiQ5IRJ6.
PhosphoSiteiQ5IRJ6.

Expressioni

Gene expression databases

BgeeiQ5IRJ6.
ExpressionAtlasiQ5IRJ6. baseline and differential.
GenevisibleiQ5IRJ6. MM.

Interactioni

Subunit structurei

Interacts with GRIP1, ESR1, AR and CTNNB1.2 Publications

GO - Molecular functioni

  • ligand-dependent nuclear receptor binding Source: MGI

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000124047.

Structurei

3D structure databases

ProteinModelPortaliQ5IRJ6.
SMRiQ5IRJ6. Positions 123-216, 251-483.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi461 – 4655LXXLL motif

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2802. Eukaryota.
COG0053. LUCA.
GeneTreeiENSGT00390000008346.
HOVERGENiHBG104893.
InParanoidiQ5IRJ6.
KOiK14696.
OMAiFKLLAWV.
OrthoDBiEOG7PCJHN.
PhylomeDBiQ5IRJ6.
TreeFamiTF314526.

Family and domain databases

Gene3Di1.20.1510.10. 1 hit.
3.90.530.10. 1 hit.
InterProiIPR002524. Cation_efflux.
IPR027469. Cation_efflux_TMD.
IPR009061. DNA-bd_dom_put.
IPR022656. XPA_C.
[Graphical view]
PfamiPF01545. Cation_efflux. 1 hit.
[Graphical view]
SUPFAMiSSF46955. SSF46955. 1 hit.
TIGRFAMsiTIGR01297. CDF. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5IRJ6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFPGLAAAAA AHRCSWAALC RLGGGRAATR GRSQGWKNVM TFESFTYVVP
60 70 80 90 100
DIHPHLSIIN QVKLYSTNVQ KGGQGSQTPK ADKVPSLTQT VENIGAELKA
110 120 130 140 150
PLKQDPLQVR VKAVLKKRDY GSKYTKNNFI TGVRAINEFC LKSSDLEQLR
160 170 180 190 200
KIRRRSPHDD TESFTVFLRS DVEAKALEVW GSLEALAREK KLRKEAEIEY
210 220 230 240 250
RERLFRNQRI LREYGDFLGN TKPRSRAVSV FLKGPGKVVM VAICINGLNC
260 270 280 290 300
FFKFLAWIYT GSASMFSEAI HSLSDTCNQG LLALGISKSV QTPDPSHPYG
310 320 330 340 350
FSNMRYISSL ISGVGIFMMG AGLSWYHGIM GLLHPQPMES LLWAYCILAG
360 370 380 390 400
SLVSEGATLL VAINELRRSA QAKGTTFYKY VMESRDPSTN VILLEDTAAV
410 420 430 440 450
LGVIIAATCM GLTSITGNPL YDSLGSLGVG TLLGVVSAFL IYTNTEALLG
460 470 480 490 500
RSIQPEQVQR LTELLESDPS VRAIHDVKAT DLGLGKVRFK AEVDFDGRVV
510 520 530 540 550
TRSYLEKQDF DQMMQEIQEV KTPEQLEAFM LKHGENIIDT LGAEVDRLEK
560
ELKKRNPEVR HVDLEIL
Length:567
Mass (Da):62,875
Last modified:July 24, 2007 - v2
Checksum:i64105C5D7D7D9A64
GO
Isoform 2 (identifier: Q5IRJ6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MFPGLA → MESVGAAGGSEAGGGVRVGASAPPGCFRAWP

Note: No experimental confirmation available.
Show »
Length:592
Mass (Da):65,130
Checksum:iB2E1EEF753A7E4EE
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti35 – 384GWKN → HASD in AAH27806 (PubMed:15489334).Curated
Sequence conflicti91 – 911V → A in AAV85854 (PubMed:15988012).Curated
Sequence conflicti91 – 911V → A in AAH27806 (PubMed:15489334).Curated
Sequence conflicti376 – 3761T → S in AAH31705 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 66MFPGLA → MESVGAAGGSEAGGGVRVGA SAPPGCFRAWP in isoform 2. 1 PublicationVSP_027088

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY682914 mRNA. Translation: AAV85854.1.
AK028885 mRNA. Translation: BAC26172.1.
AK033990 mRNA. Translation: BAC28540.1.
AK035541 mRNA. Translation: BAC29097.1.
AK082853 mRNA. Translation: BAC38654.1.
BC027806 mRNA. Translation: AAH27806.1.
BC026565 mRNA. Translation: AAH26565.1.
BC031705 mRNA. Translation: AAH31705.1.
BC055773 mRNA. Translation: AAH55773.1.
BC078440 mRNA. Translation: AAH78440.1.
AF263460 mRNA. Translation: AAF73055.1.
CCDSiCCDS39103.1. [Q5IRJ6-1]
RefSeqiNP_001297558.1. NM_001310629.1.
NP_848766.2. NM_178651.4. [Q5IRJ6-1]
UniGeneiMm.234455.

Genome annotation databases

EnsembliENSMUST00000162372; ENSMUSP00000124047; ENSMUSG00000029221. [Q5IRJ6-1]
GeneIDi109108.
KEGGimmu:109108.
UCSCiuc008xpt.1. mouse. [Q5IRJ6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY682914 mRNA. Translation: AAV85854.1.
AK028885 mRNA. Translation: BAC26172.1.
AK033990 mRNA. Translation: BAC28540.1.
AK035541 mRNA. Translation: BAC29097.1.
AK082853 mRNA. Translation: BAC38654.1.
BC027806 mRNA. Translation: AAH27806.1.
BC026565 mRNA. Translation: AAH26565.1.
BC031705 mRNA. Translation: AAH31705.1.
BC055773 mRNA. Translation: AAH55773.1.
BC078440 mRNA. Translation: AAH78440.1.
AF263460 mRNA. Translation: AAF73055.1.
CCDSiCCDS39103.1. [Q5IRJ6-1]
RefSeqiNP_001297558.1. NM_001310629.1.
NP_848766.2. NM_178651.4. [Q5IRJ6-1]
UniGeneiMm.234455.

3D structure databases

ProteinModelPortaliQ5IRJ6.
SMRiQ5IRJ6. Positions 123-216, 251-483.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000124047.

PTM databases

iPTMnetiQ5IRJ6.
PhosphoSiteiQ5IRJ6.

Proteomic databases

EPDiQ5IRJ6.
MaxQBiQ5IRJ6.
PaxDbiQ5IRJ6.
PRIDEiQ5IRJ6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000162372; ENSMUSP00000124047; ENSMUSG00000029221. [Q5IRJ6-1]
GeneIDi109108.
KEGGimmu:109108.
UCSCiuc008xpt.1. mouse. [Q5IRJ6-1]

Organism-specific databases

CTDi10463.
MGIiMGI:1923690. Slc30a9.

Phylogenomic databases

eggNOGiKOG2802. Eukaryota.
COG0053. LUCA.
GeneTreeiENSGT00390000008346.
HOVERGENiHBG104893.
InParanoidiQ5IRJ6.
KOiK14696.
OMAiFKLLAWV.
OrthoDBiEOG7PCJHN.
PhylomeDBiQ5IRJ6.
TreeFamiTF314526.

Miscellaneous databases

ChiTaRSiSlc30a9. mouse.
PROiQ5IRJ6.
SOURCEiSearch...

Gene expression databases

BgeeiQ5IRJ6.
ExpressionAtlasiQ5IRJ6. baseline and differential.
GenevisibleiQ5IRJ6. MM.

Family and domain databases

Gene3Di1.20.1510.10. 1 hit.
3.90.530.10. 1 hit.
InterProiIPR002524. Cation_efflux.
IPR027469. Cation_efflux_TMD.
IPR009061. DNA-bd_dom_put.
IPR022656. XPA_C.
[Graphical view]
PfamiPF01545. Cation_efflux. 1 hit.
[Graphical view]
SUPFAMiSSF46955. SSF46955. 1 hit.
TIGRFAMsiTIGR01297. CDF. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "GAC63, a GRIP1-dependent nuclear receptor coactivator."
    Chen Y.-H., Kim J.H., Stallcup M.R.
    Mol. Cell. Biol. 25:5965-5972(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH GRIP1; ESR1 AND AR.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Diencephalon, Skin and Urinary bladder.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 35-567 (ISOFORMS 1/2).
    Strain: C57BL/6J, Czech II and FVB/N.
    Tissue: Brain, Kidney and Mammary tumor.
  4. "The novel human HUEL (C4orf1) protein shares homology with the DNA-binding domain of the XPA DNA repair protein and displays nuclear translocation in a cell cycle-dependent manner."
    Sim D.L.C., Yeo W.M., Chow V.T.K.
    Int. J. Biochem. Cell Biol. 34:487-504(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 104-533 (ISOFORMS 1/2), SUBCELLULAR LOCATION.
  5. "Role of GAC63 in transcriptional activation mediated by beta-catenin."
    Chen Y.H., Yang C.K., Xia M., Ou C.Y., Stallcup M.R.
    Nucleic Acids Res. 35:2084-2092(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CTNNB1.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart and Testis.

Entry informationi

Entry nameiZNT9_MOUSE
AccessioniPrimary (citable) accession number: Q5IRJ6
Secondary accession number(s): Q66L46
, Q7TNE9, Q8BGX8, Q8BUR1, Q8BZP2, Q8K2E0, Q8K376, Q8R0P1, Q9JK46
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 24, 2007
Last modified: June 8, 2016
This is version 81 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.