Q5HYK7 (SH319_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 72.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SH3 domain-containing protein 19 Alternative name(s): ADAM-binding protein Eve-1 EEN-binding protein Short name=EBP | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 790 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in regulating A disintegrin and metalloproteases (ADAMs) in the signaling of EGFR-ligand shedding. May be involved in suppression of Ras-induced cellular transformation and Ras-mediated activation of ELK1. Plays a role in the regulation of cell morphology and cytoskeletal organization. Ref.6 Ref.7 Ref.9 |
| Subunit structure | Interacts with ADAM12. Isoform 4 and isoform 5 (but not isoform 1 and isoform 2) interact with ADAM9, ADAM10, ADAM15 and ADAM17. Interacts with SH3GL1 SH3 domain. Interacts via SH3 3 and SH3 4 or SH3 4 and SH3 5 domains with SOS2. Probably forms a trimeric complex with SH3GL1 and SOS2. Interacts with SH3YL1 By similarity. Ref.6 Ref.7 |
| Subcellular location | Cytoplasm. Nucleus. Note: Is recruited to the nucleus by the MLL-EEN fusion protein;. Ref.6 |
| Tissue specificity | Widely expressed with highest levels in heart, skeletal muscle, kidney, liver, placenta, small intestine and lung. Expressed at low levels in colon, thymus, spleen and leukocytes. Ref.7 |
| Sequence similarities | Contains 5 SH3 domains. |
| Caution | It is uncertain whether Met-1 or Met-4 is the initiator. |
| Sequence caution | The sequence AAI08891.1 differs from that shown. Reason: Erroneous initiation. The sequence AAI08892.1 differs from that shown. Reason: Erroneous initiation. The sequence AAI08893.1 differs from that shown. Reason: Erroneous initiation. The sequence AAI08894.1 differs from that shown. Reason: Erroneous initiation. The sequence BAF83714.1 differs from that shown. Reason: Erroneous initiation. The sequence CAI46052.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat SH3 domain |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cellular membrane organization Traceable author statement. Source: Reactome cytoskeleton organizationInferred from mutant phenotype Ref.9. Source: UniProtKB positive regulation of membrane protein ectodomain proteolysisInferred from mutant phenotype Ref.7. Source: BHF-UCL post-Golgi vesicle-mediated transportTraceable author statement. Source: Reactome regulation of cell morphogenesisInferred from mutant phenotype Ref.9. Source: UniProtKB |
| Cellular_component | Golgi apparatus Inferred from direct assay. Source: HPA cytosolTraceable author statement. Source: Reactome nucleusInferred from direct assay. Source: HPA plasma membraneInferred from direct assay Ref.7. Source: BHF-UCL |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5HYK7-1) Also known as: Eve-1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5HYK7-2) Also known as: Eve-1b; The sequence of this isoform differs from the canonical sequence as follows: 415-437: Missing. | ||||||
| Isoform 3 (identifier: Q5HYK7-3) The sequence of this isoform differs from the canonical sequence as follows: 232-268: DPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKC → G 415-437: Missing. | ||||||
| Isoform 4 (identifier: Q5HYK7-4) Also known as: Eve-1c; The sequence of this isoform differs from the canonical sequence as follows: 1-370: Missing. | ||||||
| Isoform 5 (identifier: Q5HYK7-5) Also known as: Eve-1d; The sequence of this isoform differs from the canonical sequence as follows: 1-370: Missing. 415-437: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 790 | 790 | SH3 domain-containing protein 19 | PRO_0000318197 | |||||
Regions | |||||||||
| Domain | 415 – 470 | 56 | SH3 1 | ||||||
| Domain | 495 – 554 | 60 | SH3 2 | ||||||
| Domain | 571 – 630 | 60 | SH3 3 | ||||||
| Domain | 661 – 720 | 60 | SH3 4 | ||||||
| Domain | 730 – 789 | 60 | SH3 5 | ||||||
| Region | 342 – 358 | 17 | Interaction with SH3GL1 | ||||||
| Compositional bias | 86 – 350 | 265 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 677 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 370 | 370 | Missing in isoform 4 and isoform 5. | VSP_031182 | |||||
| Alternative sequence | 232 – 268 | 37 | DPFQL…KPGKC → G in isoform 3. | VSP_031183 | |||||
| Alternative sequence | 415 – 437 | 23 | Missing in isoform 2, isoform 3 and isoform 5. | VSP_031184 | |||||
Experimental info | |||||||||
| Sequence conflict | 1 | 1 | M → V in CAI46052. Ref.2 | ||||||
| Sequence conflict | 264 | 1 | K → R in CAI46052. Ref.2 | ||||||
| Sequence conflict | 267 | 1 | K → E in CAI46052. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 275-790 (ISOFORM 1). Tissue: Amygdala. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Colon endothelium and Testis. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 312-790 (ISOFORM 1). Tissue: Brain, Chondrosarcoma and Lung. |
| [6] | "Identification and characterization of EBP, a novel EEN binding protein that inhibits Ras signaling and is recruited into the nucleus by the MLL-EEN fusion protein." Yam J.W., Jin D.Y., So C.W., Chan L.C. Blood 103:1445-1453(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SH3GL1 AND SOS2. |
| [7] | "ADAM binding protein Eve-1 is required for ectodomain shedding of epidermal growth factor receptor ligands." Tanaka M., Nanba D., Mori S., Shiba F., Ishiguro H., Yoshino K., Matsuura N., Higashiyama S. J. Biol. Chem. 279:41950-41959(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ALTERNATIVE SPLICING (ISOFORMS 1; 2; 4 AND 5), TISSUE SPECIFICITY, INTERACTION WITH ADAM9; ADAM10; ADAM12; ADAM15 AND ADAM17. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [9] | "Identification and characterization of a set of conserved and new regulators of cytoskeletal organisation, cell morphology and migration." Bai S.W., Herrera-Abreu M.T., Rohn J.L., Racine V., Tajadura V., Suryavanshi N., Bechtel S., Wiemann S., Baum B., Ridley A.J. BMC Biol. 9:54-54(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK291025 mRNA. Translation: BAF83714.1. Different initiation. AK294476 mRNA. Translation: BAH11782.1. AL133047 mRNA. Translation: CAB61374.1. BX647422 mRNA. Translation: CAI46052.1. Different initiation. AC095055 Genomic DNA. No translation available. CH471056 Genomic DNA. Translation: EAX04986.1. BC032468 mRNA. Translation: AAH32468.1. BC045742 mRNA. Translation: AAH45742.1. BC085613 mRNA. Translation: AAH85613.2. BC108890 mRNA. Translation: AAI08891.1. Different initiation. BC108891 mRNA. Translation: AAI08892.1. Different initiation. BC108892 mRNA. Translation: AAI08893.1. Different initiation. BC108893 mRNA. Translation: AAI08894.1. Different initiation. |
| IPI | IPI00472155. IPI00884903. IPI00884923. IPI00885020. IPI00885212. |
| RefSeq | NP_001009555.3. NM_001009555.3. NP_001122395.1. NM_001128923.1. NP_001122396.1. NM_001128924.1. NP_001230278.1. NM_001243349.1. |
| UniGene | Hs.567725. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1GRI based on UniProtKB P62993. |
| ProteinModelPortal | Q5HYK7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5HYK7. 4 interactions. |
| MINT | MINT-1203586. |
| STRING | 9606.ENSP00000302913. |
PTM databases | |
| PhosphoSite | Q5HYK7. |
Polymorphism databases | |
| DMDM | 166977688. |
Proteomic databases | |
| PaxDb | Q5HYK7. |
| PRIDE | Q5HYK7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000304527; ENSP00000302913; ENSG00000109686. ENST00000409252; ENSP00000386848; ENSG00000109686. ENST00000409598; ENSP00000387030; ENSG00000109686. ENST00000424281; ENSP00000404542; ENSG00000109686. ENST00000427414; ENSP00000415694; ENSG00000109686. ENST00000455740; ENSP00000416708; ENSG00000109686. ENST00000514152; ENSP00000423449; ENSG00000109686. |
| GeneID | 152503. |
| KEGG | hsa:152503. |
| UCSC | uc003imc.2. human. uc003ime.2. human. uc010ipl.1. human. |
Organism-specific databases | |
| CTD | 152503. |
| GeneCards | GC04M152041. |
| HGNC | HGNC:30418. SH3D19. |
| HPA | HPA016424. |
| MIM | 608674. gene. |
| neXtProt | NX_Q5HYK7. |
| PharmGKB | PA162403244. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG296456. |
| HOVERGEN | HBG108486. |
| InParanoid | Q5HYK7. |
| OMA | MNIMNTE. |
| OrthoDB | EOG4GB75H. |
Enzyme and pathway databases | |
| Reactome | REACT_11123. Membrane Trafficking. |
Gene expression databases | |
| ArrayExpress | Q5HYK7. |
| Bgee | Q5HYK7. |
| CleanEx | HS_SH3D19. |
| Genevestigator | Q5HYK7. |
Family and domain databases | |
| InterPro | IPR000108. p67phox. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] |
| Pfam | PF00018. SH3_1. 4 hits. PF07653. SH3_2. 1 hit. [Graphical view] |
| PRINTS | PR00499. P67PHOX. PR00452. SH3DOMAIN. |
| SMART | SM00326. SH3. 5 hits. [Graphical view] |
| SUPFAM | SSF50044. SH3. 5 hits. |
| PROSITE | PS50002. SH3. 4 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SH3D19. human. |
| GenomeRNAi | 152503. |
| NextBio | 86965. |
| SOURCE | Search... |
Entry information
| Entry name | SH319_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5HYK7 Secondary accession number(s): B7Z296 Q9UFC8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
