Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5HYK7

- SH319_HUMAN

UniProt

Q5HYK7 - SH319_HUMAN

Protein

SH3 domain-containing protein 19

Gene

SH3D19

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 86 (01 Oct 2014)
      Sequence version 2 (05 Feb 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in regulating A disintegrin and metalloproteases (ADAMs) in the signaling of EGFR-ligand shedding. May be involved in suppression of Ras-induced cellular transformation and Ras-mediated activation of ELK1. Plays a role in the regulation of cell morphology and cytoskeletal organization.3 Publications

    GO - Molecular functioni

    1. proline-rich region binding Source: BHF-UCL
    2. protein binding Source: UniProtKB

    GO - Biological processi

    1. cytoskeleton organization Source: UniProtKB
    2. membrane organization Source: Reactome
    3. positive regulation of membrane protein ectodomain proteolysis Source: BHF-UCL
    4. post-Golgi vesicle-mediated transport Source: Reactome
    5. regulation of cell morphogenesis Source: UniProtKB

    Enzyme and pathway databases

    ReactomeiREACT_19400. Golgi Associated Vesicle Biogenesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    SH3 domain-containing protein 19
    Alternative name(s):
    ADAM-binding protein Eve-1
    EEN-binding protein
    Short name:
    EBP
    Gene namesi
    Name:SH3D19
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:30418. SH3D19.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication
    Note: Is recruited to the nucleus by the KMT2A/MLL1-EEN fusion protein.

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. Golgi apparatus Source: HPA
    3. nucleus Source: HPA
    4. plasma membrane Source: BHF-UCL

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162403244.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 790790SH3 domain-containing protein 19PRO_0000318197Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei65 – 651PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ5HYK7.
    PaxDbiQ5HYK7.
    PRIDEiQ5HYK7.

    PTM databases

    PhosphoSiteiQ5HYK7.

    Expressioni

    Tissue specificityi

    Widely expressed with highest levels in heart, skeletal muscle, kidney, liver, placenta, small intestine and lung. Expressed at low levels in colon, thymus, spleen and leukocytes.1 Publication

    Gene expression databases

    ArrayExpressiQ5HYK7.
    BgeeiQ5HYK7.
    CleanExiHS_SH3D19.
    GenevestigatoriQ5HYK7.

    Organism-specific databases

    HPAiHPA016424.

    Interactioni

    Subunit structurei

    Interacts with ADAM12. Isoform 4 and isoform 5 (but not isoform 1 and isoform 2) interact with ADAM9, ADAM10, ADAM15 and ADAM17. Interacts with SH3GL1 SH3 domain. Interacts via SH3 3 and SH3 4 or SH3 4 and SH3 5 domains with SOS2. Probably forms a trimeric complex with SH3GL1 and SOS2. Interacts with SH3YL1 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi127448. 6 interactions.
    IntActiQ5HYK7. 4 interactions.
    MINTiMINT-1203586.
    STRINGi9606.ENSP00000302913.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5HYK7.
    SMRiQ5HYK7. Positions 421-472, 503-787.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini415 – 47056SH3 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini495 – 55460SH3 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini571 – 63060SH3 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini661 – 72060SH3 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini730 – 78960SH3 5PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni342 – 35817Interaction with SH3GL1Add
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi86 – 350265Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 5 SH3 domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, SH3 domain

    Phylogenomic databases

    eggNOGiNOG296456.
    HOVERGENiHBG108486.
    InParanoidiQ5HYK7.
    OMAiVLDPFQL.
    OrthoDBiEOG761BW2.
    PhylomeDBiQ5HYK7.
    TreeFamiTF330850.

    Family and domain databases

    InterProiIPR011511. SH3_2.
    IPR001452. SH3_domain.
    IPR028505. SH3D19.
    [Graphical view]
    PANTHERiPTHR10661:SF127. PTHR10661:SF127. 1 hit.
    PfamiPF00018. SH3_1. 2 hits.
    PF07653. SH3_2. 1 hit.
    PF14604. SH3_9. 2 hits.
    [Graphical view]
    PRINTSiPR00452. SH3DOMAIN.
    SMARTiSM00326. SH3. 5 hits.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 5 hits.
    PROSITEiPS50002. SH3. 4 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5HYK7-1) [UniParc]FASTAAdd to Basket

    Also known as: Eve-1a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNIMNTEQSQ NSIVSRIKVF EGQTNIETSG LPKKPEITPR SLPPKPTVSS    50
    GKPSVAPKPA ANRASGEWDS GTENRLKVTS KEGLTPYPPL QEAGSIPVTK 100
    PELPKKPNPG LIRSVNPEIP GRGPLAESSD SGKKVPTPAP RPLLLKKSVS 150
    SENPTYPSAP LKPVTVPPRL AGASQAKAYK SLGEGPPANP PVPVLQSKPL 200
    VDIDLISFDD DVLPTPSGNL AEESVGSEMV LDPFQLPAKT EPIKERAVQP 250
    APTRKPTVIR IPAKPGKCLH EDPQSPPPLP AEKPIGNTFS TVSGKLSNVE 300
    RTRNLESNHP GQTGGFVRVP PRLPPRPVNG KTIPTQQPPT KVPPERPPPP 350
    KLSATRRSNK KLPFNRSSSD MDLQKKQSNL ATGLSKAKSQ VFKNQDPVLP 400
    PRPKPGHPLY SKYMLSVPHG IANEDIVSQN PGELSCKRGD VLVMLKQTEN 450
    NYLECQKGED TGRVHLSQMK IITPLDEHLR SRPNDPSHAQ KPVDSGAPHA 500
    VVLHDFPAEQ VDDLNLTSGE IVYLLEKIDT DWYRGNCRNQ IGIFPANYVK 550
    VIIDIPEGGN GKRECVSSHC VKGSRCVARF EYIGEQKDEL SFSEGEIIIL 600
    KEYVNEEWAR GEVRGRTGIF PLNFVEPVED YPTSGANVLS TKVPLKTKKE 650
    DSGSNSQVNS LPAEWCEALH SFTAETSDDL SFKRGDRIQI LERLDSDWCR 700
    GRLQDREGIF PAVFVRPCPA EAKSMLAIVP KGRKAKALYD FRGENEDELS 750
    FKAGDIITEL ESVDDDWMSG ELMGKSGIFP KNYIQFLQIS 790
    Length:790
    Mass (Da):86,525
    Last modified:February 5, 2008 - v2
    Checksum:iFA860FB41FE8CDD5
    GO
    Isoform 2 (identifier: Q5HYK7-2) [UniParc]FASTAAdd to Basket

    Also known as: Eve-1b

    The sequence of this isoform differs from the canonical sequence as follows:
         415-437: Missing.

    Show »
    Length:767
    Mass (Da):84,136
    Checksum:i9DC52412DD810D43
    GO
    Isoform 3 (identifier: Q5HYK7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         232-268: DPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKC → G
         415-437: Missing.

    Show »
    Length:731
    Mass (Da):80,131
    Checksum:i34B191C247F3D367
    GO
    Isoform 4 (identifier: Q5HYK7-4) [UniParc]FASTAAdd to Basket

    Also known as: Eve-1c

    The sequence of this isoform differs from the canonical sequence as follows:
         1-370: Missing.

    Show »
    Length:420
    Mass (Da):47,056
    Checksum:iC49CE5F2A5DCAF1C
    GO
    Isoform 5 (identifier: Q5HYK7-5) [UniParc]FASTAAdd to Basket

    Also known as: Eve-1d

    The sequence of this isoform differs from the canonical sequence as follows:
         1-370: Missing.
         415-437: Missing.

    Show »
    Length:397
    Mass (Da):44,667
    Checksum:i813BAA810E48B27B
    GO

    Sequence cautioni

    The sequence AAI08891.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAI08892.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAI08893.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAI08894.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAF83714.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAI46052.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1 – 11M → V in CAI46052. (PubMed:17974005)Curated
    Sequence conflicti264 – 2641K → R in CAI46052. (PubMed:17974005)Curated
    Sequence conflicti267 – 2671K → E in CAI46052. (PubMed:17974005)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 370370Missing in isoform 4 and isoform 5. CuratedVSP_031182Add
    BLAST
    Alternative sequencei232 – 26837DPFQL…KPGKC → G in isoform 3. 1 PublicationVSP_031183Add
    BLAST
    Alternative sequencei415 – 43723Missing in isoform 2, isoform 3 and isoform 5. 2 PublicationsVSP_031184Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK291025 mRNA. Translation: BAF83714.1. Different initiation.
    AK294476 mRNA. Translation: BAH11782.1.
    AL133047 mRNA. Translation: CAB61374.1.
    BX647422 mRNA. Translation: CAI46052.1. Different initiation.
    AC095055 Genomic DNA. No translation available.
    CH471056 Genomic DNA. Translation: EAX04986.1.
    BC032468 mRNA. Translation: AAH32468.1.
    BC045742 mRNA. Translation: AAH45742.1.
    BC085613 mRNA. Translation: AAH85613.2.
    BC108890 mRNA. Translation: AAI08891.1. Different initiation.
    BC108891 mRNA. Translation: AAI08892.1. Different initiation.
    BC108892 mRNA. Translation: AAI08893.1. Different initiation.
    BC108893 mRNA. Translation: AAI08894.1. Different initiation.
    CCDSiCCDS34077.2. [Q5HYK7-1]
    CCDS47143.1. [Q5HYK7-3]
    CCDS47144.1. [Q5HYK7-2]
    RefSeqiNP_001009555.3. NM_001009555.3. [Q5HYK7-1]
    NP_001122395.1. NM_001128923.1. [Q5HYK7-2]
    NP_001122396.1. NM_001128924.1. [Q5HYK7-3]
    NP_001230278.1. NM_001243349.1. [Q5HYK7-2]
    XP_005262824.1. XM_005262767.1. [Q5HYK7-1]
    XP_006714165.1. XM_006714102.1. [Q5HYK7-1]
    UniGeneiHs.744983.

    Genome annotation databases

    EnsembliENST00000304527; ENSP00000302913; ENSG00000109686. [Q5HYK7-1]
    ENST00000409252; ENSP00000386848; ENSG00000109686. [Q5HYK7-1]
    ENST00000409598; ENSP00000387030; ENSG00000109686. [Q5HYK7-2]
    ENST00000427414; ENSP00000415694; ENSG00000109686. [Q5HYK7-3]
    ENST00000514152; ENSP00000423449; ENSG00000109686. [Q5HYK7-2]
    GeneIDi152503.
    KEGGihsa:152503.
    UCSCiuc003imc.2. human. [Q5HYK7-3]
    uc003ime.2. human. [Q5HYK7-2]
    uc010ipl.1. human. [Q5HYK7-1]

    Polymorphism databases

    DMDMi166977688.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK291025 mRNA. Translation: BAF83714.1 . Different initiation.
    AK294476 mRNA. Translation: BAH11782.1 .
    AL133047 mRNA. Translation: CAB61374.1 .
    BX647422 mRNA. Translation: CAI46052.1 . Different initiation.
    AC095055 Genomic DNA. No translation available.
    CH471056 Genomic DNA. Translation: EAX04986.1 .
    BC032468 mRNA. Translation: AAH32468.1 .
    BC045742 mRNA. Translation: AAH45742.1 .
    BC085613 mRNA. Translation: AAH85613.2 .
    BC108890 mRNA. Translation: AAI08891.1 . Different initiation.
    BC108891 mRNA. Translation: AAI08892.1 . Different initiation.
    BC108892 mRNA. Translation: AAI08893.1 . Different initiation.
    BC108893 mRNA. Translation: AAI08894.1 . Different initiation.
    CCDSi CCDS34077.2. [Q5HYK7-1 ]
    CCDS47143.1. [Q5HYK7-3 ]
    CCDS47144.1. [Q5HYK7-2 ]
    RefSeqi NP_001009555.3. NM_001009555.3. [Q5HYK7-1 ]
    NP_001122395.1. NM_001128923.1. [Q5HYK7-2 ]
    NP_001122396.1. NM_001128924.1. [Q5HYK7-3 ]
    NP_001230278.1. NM_001243349.1. [Q5HYK7-2 ]
    XP_005262824.1. XM_005262767.1. [Q5HYK7-1 ]
    XP_006714165.1. XM_006714102.1. [Q5HYK7-1 ]
    UniGenei Hs.744983.

    3D structure databases

    ProteinModelPortali Q5HYK7.
    SMRi Q5HYK7. Positions 421-472, 503-787.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127448. 6 interactions.
    IntActi Q5HYK7. 4 interactions.
    MINTi MINT-1203586.
    STRINGi 9606.ENSP00000302913.

    PTM databases

    PhosphoSitei Q5HYK7.

    Polymorphism databases

    DMDMi 166977688.

    Proteomic databases

    MaxQBi Q5HYK7.
    PaxDbi Q5HYK7.
    PRIDEi Q5HYK7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000304527 ; ENSP00000302913 ; ENSG00000109686 . [Q5HYK7-1 ]
    ENST00000409252 ; ENSP00000386848 ; ENSG00000109686 . [Q5HYK7-1 ]
    ENST00000409598 ; ENSP00000387030 ; ENSG00000109686 . [Q5HYK7-2 ]
    ENST00000427414 ; ENSP00000415694 ; ENSG00000109686 . [Q5HYK7-3 ]
    ENST00000514152 ; ENSP00000423449 ; ENSG00000109686 . [Q5HYK7-2 ]
    GeneIDi 152503.
    KEGGi hsa:152503.
    UCSCi uc003imc.2. human. [Q5HYK7-3 ]
    uc003ime.2. human. [Q5HYK7-2 ]
    uc010ipl.1. human. [Q5HYK7-1 ]

    Organism-specific databases

    CTDi 152503.
    GeneCardsi GC04M152041.
    HGNCi HGNC:30418. SH3D19.
    HPAi HPA016424.
    MIMi 608674. gene.
    neXtProti NX_Q5HYK7.
    PharmGKBi PA162403244.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG296456.
    HOVERGENi HBG108486.
    InParanoidi Q5HYK7.
    OMAi VLDPFQL.
    OrthoDBi EOG761BW2.
    PhylomeDBi Q5HYK7.
    TreeFami TF330850.

    Enzyme and pathway databases

    Reactomei REACT_19400. Golgi Associated Vesicle Biogenesis.

    Miscellaneous databases

    ChiTaRSi SH3D19. human.
    GenomeRNAii 152503.
    NextBioi 86965.
    PROi Q5HYK7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q5HYK7.
    Bgeei Q5HYK7.
    CleanExi HS_SH3D19.
    Genevestigatori Q5HYK7.

    Family and domain databases

    InterProi IPR011511. SH3_2.
    IPR001452. SH3_domain.
    IPR028505. SH3D19.
    [Graphical view ]
    PANTHERi PTHR10661:SF127. PTHR10661:SF127. 1 hit.
    Pfami PF00018. SH3_1. 2 hits.
    PF07653. SH3_2. 1 hit.
    PF14604. SH3_9. 2 hits.
    [Graphical view ]
    PRINTSi PR00452. SH3DOMAIN.
    SMARTi SM00326. SH3. 5 hits.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 5 hits.
    PROSITEi PS50002. SH3. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 275-790 (ISOFORM 1).
      Tissue: Amygdala.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon endothelium and Testis.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 312-790 (ISOFORM 1).
      Tissue: Brain, Chondrosarcoma and Lung.
    6. "Identification and characterization of EBP, a novel EEN binding protein that inhibits Ras signaling and is recruited into the nucleus by the MLL-EEN fusion protein."
      Yam J.W., Jin D.Y., So C.W., Chan L.C.
      Blood 103:1445-1453(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SH3GL1 AND SOS2.
    7. "ADAM binding protein Eve-1 is required for ectodomain shedding of epidermal growth factor receptor ligands."
      Tanaka M., Nanba D., Mori S., Shiba F., Ishiguro H., Yoshino K., Matsuura N., Higashiyama S.
      J. Biol. Chem. 279:41950-41959(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, ALTERNATIVE SPLICING (ISOFORMS 1; 2; 4 AND 5), TISSUE SPECIFICITY, INTERACTION WITH ADAM9; ADAM10; ADAM12; ADAM15 AND ADAM17.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Identification and characterization of a set of conserved and new regulators of cytoskeletal organisation, cell morphology and migration."
      Bai S.W., Herrera-Abreu M.T., Rohn J.L., Racine V., Tajadura V., Suryavanshi N., Bechtel S., Wiemann S., Baum B., Ridley A.J.
      BMC Biol. 9:54-54(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSH319_HUMAN
    AccessioniPrimary (citable) accession number: Q5HYK7
    Secondary accession number(s): B7Z296
    , Q08EK1, Q32N10, Q5U3B8, Q86XB3, Q8N5E7, Q9UFC8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 5, 2008
    Last sequence update: February 5, 2008
    Last modified: October 1, 2014
    This is version 86 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Caution

    It is uncertain whether Met-1 or Met-4 is the initiator.Curated

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3