SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5HYK7

- SH319_HUMAN

UniProt

Q5HYK7 - SH319_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

SH3 domain-containing protein 19

Gene
SH3D19
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May play a role in regulating A disintegrin and metalloproteases (ADAMs) in the signaling of EGFR-ligand shedding. May be involved in suppression of Ras-induced cellular transformation and Ras-mediated activation of ELK1. Plays a role in the regulation of cell morphology and cytoskeletal organization.3 Publications

GO - Molecular functioni

  1. proline-rich region binding Source: BHF-UCL
  2. protein binding Source: UniProtKB

GO - Biological processi

  1. cytoskeleton organization Source: UniProtKB
  2. membrane organization Source: Reactome
  3. positive regulation of membrane protein ectodomain proteolysis Source: BHF-UCL
  4. post-Golgi vesicle-mediated transport Source: Reactome
  5. regulation of cell morphogenesis Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_19400. Golgi Associated Vesicle Biogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
SH3 domain-containing protein 19
Alternative name(s):
ADAM-binding protein Eve-1
EEN-binding protein
Short name:
EBP
Gene namesi
Name:SH3D19
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:30418. SH3D19.

Subcellular locationi

Cytoplasm. Nucleus
Note: Is recruited to the nucleus by the KMT2A/MLL1-EEN fusion protein.1 Publication

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. Golgi apparatus Source: HPA
  3. nucleus Source: HPA
  4. plasma membrane Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162403244.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 790790SH3 domain-containing protein 19PRO_0000318197Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei65 – 651Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ5HYK7.
PaxDbiQ5HYK7.
PRIDEiQ5HYK7.

PTM databases

PhosphoSiteiQ5HYK7.

Expressioni

Tissue specificityi

Widely expressed with highest levels in heart, skeletal muscle, kidney, liver, placenta, small intestine and lung. Expressed at low levels in colon, thymus, spleen and leukocytes.1 Publication

Gene expression databases

ArrayExpressiQ5HYK7.
BgeeiQ5HYK7.
CleanExiHS_SH3D19.
GenevestigatoriQ5HYK7.

Organism-specific databases

HPAiHPA016424.

Interactioni

Subunit structurei

Interacts with ADAM12. Isoform 4 and isoform 5 (but not isoform 1 and isoform 2) interact with ADAM9, ADAM10, ADAM15 and ADAM17. Interacts with SH3GL1 SH3 domain. Interacts via SH3 3 and SH3 4 or SH3 4 and SH3 5 domains with SOS2. Probably forms a trimeric complex with SH3GL1 and SOS2. Interacts with SH3YL1 By similarity.2 Publications

Protein-protein interaction databases

BioGridi127448. 6 interactions.
IntActiQ5HYK7. 4 interactions.
MINTiMINT-1203586.
STRINGi9606.ENSP00000302913.

Structurei

3D structure databases

ProteinModelPortaliQ5HYK7.
SMRiQ5HYK7. Positions 421-472, 503-787.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini415 – 47056SH3 1Add
BLAST
Domaini495 – 55460SH3 2Add
BLAST
Domaini571 – 63060SH3 3Add
BLAST
Domaini661 – 72060SH3 4Add
BLAST
Domaini730 – 78960SH3 5Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni342 – 35817Interaction with SH3GL1Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi86 – 350265Pro-richAdd
BLAST

Sequence similaritiesi

Contains 5 SH3 domains.

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiNOG296456.
HOVERGENiHBG108486.
InParanoidiQ5HYK7.
OMAiVLDPFQL.
OrthoDBiEOG761BW2.
PhylomeDBiQ5HYK7.
TreeFamiTF330850.

Family and domain databases

InterProiIPR011511. SH3_2.
IPR001452. SH3_domain.
IPR028505. SH3D19.
[Graphical view]
PANTHERiPTHR10661:SF127. PTHR10661:SF127. 1 hit.
PfamiPF00018. SH3_1. 2 hits.
PF07653. SH3_2. 1 hit.
PF14604. SH3_9. 2 hits.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00326. SH3. 5 hits.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 5 hits.
PROSITEiPS50002. SH3. 4 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5HYK7-1) [UniParc]FASTAAdd to Basket

Also known as: Eve-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MNIMNTEQSQ NSIVSRIKVF EGQTNIETSG LPKKPEITPR SLPPKPTVSS    50
GKPSVAPKPA ANRASGEWDS GTENRLKVTS KEGLTPYPPL QEAGSIPVTK 100
PELPKKPNPG LIRSVNPEIP GRGPLAESSD SGKKVPTPAP RPLLLKKSVS 150
SENPTYPSAP LKPVTVPPRL AGASQAKAYK SLGEGPPANP PVPVLQSKPL 200
VDIDLISFDD DVLPTPSGNL AEESVGSEMV LDPFQLPAKT EPIKERAVQP 250
APTRKPTVIR IPAKPGKCLH EDPQSPPPLP AEKPIGNTFS TVSGKLSNVE 300
RTRNLESNHP GQTGGFVRVP PRLPPRPVNG KTIPTQQPPT KVPPERPPPP 350
KLSATRRSNK KLPFNRSSSD MDLQKKQSNL ATGLSKAKSQ VFKNQDPVLP 400
PRPKPGHPLY SKYMLSVPHG IANEDIVSQN PGELSCKRGD VLVMLKQTEN 450
NYLECQKGED TGRVHLSQMK IITPLDEHLR SRPNDPSHAQ KPVDSGAPHA 500
VVLHDFPAEQ VDDLNLTSGE IVYLLEKIDT DWYRGNCRNQ IGIFPANYVK 550
VIIDIPEGGN GKRECVSSHC VKGSRCVARF EYIGEQKDEL SFSEGEIIIL 600
KEYVNEEWAR GEVRGRTGIF PLNFVEPVED YPTSGANVLS TKVPLKTKKE 650
DSGSNSQVNS LPAEWCEALH SFTAETSDDL SFKRGDRIQI LERLDSDWCR 700
GRLQDREGIF PAVFVRPCPA EAKSMLAIVP KGRKAKALYD FRGENEDELS 750
FKAGDIITEL ESVDDDWMSG ELMGKSGIFP KNYIQFLQIS 790
Length:790
Mass (Da):86,525
Last modified:February 5, 2008 - v2
Checksum:iFA860FB41FE8CDD5
GO
Isoform 2 (identifier: Q5HYK7-2) [UniParc]FASTAAdd to Basket

Also known as: Eve-1b

The sequence of this isoform differs from the canonical sequence as follows:
     415-437: Missing.

Show »
Length:767
Mass (Da):84,136
Checksum:i9DC52412DD810D43
GO
Isoform 3 (identifier: Q5HYK7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-268: DPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKC → G
     415-437: Missing.

Show »
Length:731
Mass (Da):80,131
Checksum:i34B191C247F3D367
GO
Isoform 4 (identifier: Q5HYK7-4) [UniParc]FASTAAdd to Basket

Also known as: Eve-1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-370: Missing.

Show »
Length:420
Mass (Da):47,056
Checksum:iC49CE5F2A5DCAF1C
GO
Isoform 5 (identifier: Q5HYK7-5) [UniParc]FASTAAdd to Basket

Also known as: Eve-1d

The sequence of this isoform differs from the canonical sequence as follows:
     1-370: Missing.
     415-437: Missing.

Show »
Length:397
Mass (Da):44,667
Checksum:i813BAA810E48B27B
GO

Sequence cautioni

The sequence AAI08891.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAI08892.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAI08893.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAI08894.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAF83714.1 differs from that shown. Reason: Erroneous initiation.
The sequence CAI46052.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 370370Missing in isoform 4 and isoform 5. VSP_031182Add
BLAST
Alternative sequencei232 – 26837DPFQL…KPGKC → G in isoform 3. VSP_031183Add
BLAST
Alternative sequencei415 – 43723Missing in isoform 2, isoform 3 and isoform 5. VSP_031184Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1 – 11M → V in CAI46052. 1 Publication
Sequence conflicti264 – 2641K → R in CAI46052. 1 Publication
Sequence conflicti267 – 2671K → E in CAI46052. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK291025 mRNA. Translation: BAF83714.1. Different initiation.
AK294476 mRNA. Translation: BAH11782.1.
AL133047 mRNA. Translation: CAB61374.1.
BX647422 mRNA. Translation: CAI46052.1. Different initiation.
AC095055 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04986.1.
BC032468 mRNA. Translation: AAH32468.1.
BC045742 mRNA. Translation: AAH45742.1.
BC085613 mRNA. Translation: AAH85613.2.
BC108890 mRNA. Translation: AAI08891.1. Different initiation.
BC108891 mRNA. Translation: AAI08892.1. Different initiation.
BC108892 mRNA. Translation: AAI08893.1. Different initiation.
BC108893 mRNA. Translation: AAI08894.1. Different initiation.
CCDSiCCDS34077.2. [Q5HYK7-1]
CCDS47143.1. [Q5HYK7-3]
CCDS47144.1. [Q5HYK7-2]
RefSeqiNP_001009555.3. NM_001009555.3. [Q5HYK7-1]
NP_001122395.1. NM_001128923.1. [Q5HYK7-2]
NP_001122396.1. NM_001128924.1. [Q5HYK7-3]
NP_001230278.1. NM_001243349.1. [Q5HYK7-2]
XP_005262824.1. XM_005262767.1. [Q5HYK7-1]
XP_006714165.1. XM_006714102.1. [Q5HYK7-1]
UniGeneiHs.744983.

Genome annotation databases

EnsembliENST00000304527; ENSP00000302913; ENSG00000109686. [Q5HYK7-1]
ENST00000409252; ENSP00000386848; ENSG00000109686. [Q5HYK7-1]
ENST00000409598; ENSP00000387030; ENSG00000109686. [Q5HYK7-2]
ENST00000424281; ENSP00000404542; ENSG00000109686. [Q5HYK7-3]
ENST00000427414; ENSP00000415694; ENSG00000109686. [Q5HYK7-3]
ENST00000455740; ENSP00000416708; ENSG00000109686. [Q5HYK7-2]
ENST00000514152; ENSP00000423449; ENSG00000109686. [Q5HYK7-2]
GeneIDi152503.
KEGGihsa:152503.
UCSCiuc003imc.2. human. [Q5HYK7-3]
uc003ime.2. human. [Q5HYK7-2]
uc010ipl.1. human. [Q5HYK7-1]

Polymorphism databases

DMDMi166977688.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK291025 mRNA. Translation: BAF83714.1 . Different initiation.
AK294476 mRNA. Translation: BAH11782.1 .
AL133047 mRNA. Translation: CAB61374.1 .
BX647422 mRNA. Translation: CAI46052.1 . Different initiation.
AC095055 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04986.1 .
BC032468 mRNA. Translation: AAH32468.1 .
BC045742 mRNA. Translation: AAH45742.1 .
BC085613 mRNA. Translation: AAH85613.2 .
BC108890 mRNA. Translation: AAI08891.1 . Different initiation.
BC108891 mRNA. Translation: AAI08892.1 . Different initiation.
BC108892 mRNA. Translation: AAI08893.1 . Different initiation.
BC108893 mRNA. Translation: AAI08894.1 . Different initiation.
CCDSi CCDS34077.2. [Q5HYK7-1 ]
CCDS47143.1. [Q5HYK7-3 ]
CCDS47144.1. [Q5HYK7-2 ]
RefSeqi NP_001009555.3. NM_001009555.3. [Q5HYK7-1 ]
NP_001122395.1. NM_001128923.1. [Q5HYK7-2 ]
NP_001122396.1. NM_001128924.1. [Q5HYK7-3 ]
NP_001230278.1. NM_001243349.1. [Q5HYK7-2 ]
XP_005262824.1. XM_005262767.1. [Q5HYK7-1 ]
XP_006714165.1. XM_006714102.1. [Q5HYK7-1 ]
UniGenei Hs.744983.

3D structure databases

ProteinModelPortali Q5HYK7.
SMRi Q5HYK7. Positions 421-472, 503-787.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127448. 6 interactions.
IntActi Q5HYK7. 4 interactions.
MINTi MINT-1203586.
STRINGi 9606.ENSP00000302913.

PTM databases

PhosphoSitei Q5HYK7.

Polymorphism databases

DMDMi 166977688.

Proteomic databases

MaxQBi Q5HYK7.
PaxDbi Q5HYK7.
PRIDEi Q5HYK7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000304527 ; ENSP00000302913 ; ENSG00000109686 . [Q5HYK7-1 ]
ENST00000409252 ; ENSP00000386848 ; ENSG00000109686 . [Q5HYK7-1 ]
ENST00000409598 ; ENSP00000387030 ; ENSG00000109686 . [Q5HYK7-2 ]
ENST00000424281 ; ENSP00000404542 ; ENSG00000109686 . [Q5HYK7-3 ]
ENST00000427414 ; ENSP00000415694 ; ENSG00000109686 . [Q5HYK7-3 ]
ENST00000455740 ; ENSP00000416708 ; ENSG00000109686 . [Q5HYK7-2 ]
ENST00000514152 ; ENSP00000423449 ; ENSG00000109686 . [Q5HYK7-2 ]
GeneIDi 152503.
KEGGi hsa:152503.
UCSCi uc003imc.2. human. [Q5HYK7-3 ]
uc003ime.2. human. [Q5HYK7-2 ]
uc010ipl.1. human. [Q5HYK7-1 ]

Organism-specific databases

CTDi 152503.
GeneCardsi GC04M152041.
HGNCi HGNC:30418. SH3D19.
HPAi HPA016424.
MIMi 608674. gene.
neXtProti NX_Q5HYK7.
PharmGKBi PA162403244.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG296456.
HOVERGENi HBG108486.
InParanoidi Q5HYK7.
OMAi VLDPFQL.
OrthoDBi EOG761BW2.
PhylomeDBi Q5HYK7.
TreeFami TF330850.

Enzyme and pathway databases

Reactomei REACT_19400. Golgi Associated Vesicle Biogenesis.

Miscellaneous databases

ChiTaRSi SH3D19. human.
GenomeRNAii 152503.
NextBioi 86965.
PROi Q5HYK7.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q5HYK7.
Bgeei Q5HYK7.
CleanExi HS_SH3D19.
Genevestigatori Q5HYK7.

Family and domain databases

InterProi IPR011511. SH3_2.
IPR001452. SH3_domain.
IPR028505. SH3D19.
[Graphical view ]
PANTHERi PTHR10661:SF127. PTHR10661:SF127. 1 hit.
Pfami PF00018. SH3_1. 2 hits.
PF07653. SH3_2. 1 hit.
PF14604. SH3_9. 2 hits.
[Graphical view ]
PRINTSi PR00452. SH3DOMAIN.
SMARTi SM00326. SH3. 5 hits.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 5 hits.
PROSITEi PS50002. SH3. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 275-790 (ISOFORM 1).
    Tissue: Amygdala.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon endothelium and Testis.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 312-790 (ISOFORM 1).
    Tissue: Brain, Chondrosarcoma and Lung.
  6. "Identification and characterization of EBP, a novel EEN binding protein that inhibits Ras signaling and is recruited into the nucleus by the MLL-EEN fusion protein."
    Yam J.W., Jin D.Y., So C.W., Chan L.C.
    Blood 103:1445-1453(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SH3GL1 AND SOS2.
  7. "ADAM binding protein Eve-1 is required for ectodomain shedding of epidermal growth factor receptor ligands."
    Tanaka M., Nanba D., Mori S., Shiba F., Ishiguro H., Yoshino K., Matsuura N., Higashiyama S.
    J. Biol. Chem. 279:41950-41959(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, ALTERNATIVE SPLICING (ISOFORMS 1; 2; 4 AND 5), TISSUE SPECIFICITY, INTERACTION WITH ADAM9; ADAM10; ADAM12; ADAM15 AND ADAM17.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Identification and characterization of a set of conserved and new regulators of cytoskeletal organisation, cell morphology and migration."
    Bai S.W., Herrera-Abreu M.T., Rohn J.L., Racine V., Tajadura V., Suryavanshi N., Bechtel S., Wiemann S., Baum B., Ridley A.J.
    BMC Biol. 9:54-54(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSH319_HUMAN
AccessioniPrimary (citable) accession number: Q5HYK7
Secondary accession number(s): B7Z296
, Q08EK1, Q32N10, Q5U3B8, Q86XB3, Q8N5E7, Q9UFC8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: September 3, 2014
This is version 85 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-4 is the initiator.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi