Q5H913 (AR13A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 76.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: ADP-ribosylation factor-like protein 13A | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 290 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Belongs to the small GTPase superfamily. Arf family. |
| Sequence caution | The sequence CAI42661.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | GTP-binding Nucleotide-binding |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | small GTPase mediated signal transduction Inferred from electronic annotation. Source: InterPro |
| Cellular_component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular_function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5H913-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5H913-2) The sequence of this isoform differs from the canonical sequence as follows: 249-290: KEGTRLWSKKNMSVTFALDEPMKEGECSRRMRAQNTTKLCYN → PSNQSYTH | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 290 | 290 | ADP-ribosylation factor-like protein 13A | PRO_0000284145 | |||||
Regions | |||||||||
| Nucleotide binding | 28 – 35 | 8 | GTP By similarity | ||||||
| Nucleotide binding | 71 – 75 | 5 | GTP By similarity | ||||||
| Nucleotide binding | 130 – 133 | 4 | GTP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 249 – 290 | 42 | KEGTR…KLCYN → PSNQSYTH in isoform 2. | VSP_042678 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK301813 mRNA. Translation: BAG63262.1. Z97985 Genomic DNA. Translation: CAI42661.1. Sequence problems. BC140808 mRNA. Translation: AAI40809.1. BC144603 mRNA. Translation: AAI44604.1. |
| IPI | IPI00401767. |
| RefSeq | NP_001013008.2. NM_001012990.3. NP_001155962.1. NM_001162490.1. NP_001155963.1. NM_001162491.1. |
| UniGene | Hs.147237. |
3D structure databases | |
| HSSP | HSSP built from PDB template 2GAO based on UniProtKB Q9NR31. |
| ProteinModelPortal | Q5H913. |
| SMR | Q5H913. Positions 26-192. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000414757. |
PTM databases | |
| PhosphoSite | Q5H913. |
Polymorphism databases | |
| DMDM | 308153411. |
Proteomic databases | |
| PaxDb | Q5H913. |
| PRIDE | Q5H913. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000450049; ENSP00000398637; ENSG00000174225. ENST00000450457; ENSP00000414757; ENSG00000174225. |
| GeneID | 392509. |
| KEGG | hsa:392509. |
| UCSC | uc004ego.3. human. |
Organism-specific databases | |
| CTD | 392509. |
| GeneCards | GC0XP100224. |
| HGNC | HGNC:31709. ARL13A. |
| HPA | HPA037378. |
| neXtProt | NX_Q5H913. |
| PharmGKB | PA134890660. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1100. |
| HOGENOM | HOG000034025. |
| HOVERGEN | HBG103644. |
| InParanoid | Q5H913. |
| KO | K07961. |
| OMA | PSKTDHC. |
| OrthoDB | EOG4J118P. |
Gene expression databases | |
| ArrayExpress | Q5H913. |
| Bgee | Q5H913. |
| CleanEx | HS_ARL13A. |
| Genevestigator | Q5H913. |
Family and domain databases | |
| InterPro | IPR024156. Small_GTPase_ARF. IPR006689. Small_GTPase_ARF/SAR. [Graphical view] |
| Pfam | PF00025. Arf. 1 hit. [Graphical view] |
| PRINTS | PR00328. SAR1GTPBP. |
| PROSITE | PS51417. ARF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 392509. |
| NextBio | 105249. |
Entry information
| Entry name | AR13A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5H913 Secondary accession number(s): B2RTT6, B4DX50 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
