Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5H913

- AR13A_HUMAN

UniProt

Q5H913 - AR13A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

ADP-ribosylation factor-like protein 13A

Gene

ARL13A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi28 – 358GTPBy similarity
Nucleotide bindingi71 – 755GTPBy similarity
Nucleotide bindingi130 – 1334GTPBy similarity

GO - Molecular functioni

  1. GTP binding Source: UniProtKB-KW

GO - Biological processi

  1. small GTPase mediated signal transduction Source: InterPro
Complete GO annotation...

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
ADP-ribosylation factor-like protein 13A
Gene namesi
Name:ARL13A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:31709. ARL13A.

Subcellular locationi

GO - Cellular componenti

  1. intracellular Source: InterPro
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134890660.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 290290ADP-ribosylation factor-like protein 13APRO_0000284145Add
BLAST

Proteomic databases

PaxDbiQ5H913.
PRIDEiQ5H913.

PTM databases

PhosphoSiteiQ5H913.

Expressioni

Gene expression databases

BgeeiQ5H913.
CleanExiHS_ARL13A.
GenevestigatoriQ5H913.

Organism-specific databases

HPAiHPA037377.
HPA037378.

Interactioni

Protein-protein interaction databases

BioGridi134249. 4 interactions.
STRINGi9606.ENSP00000414757.

Structurei

3D structure databases

ProteinModelPortaliQ5H913.
SMRiQ5H913. Positions 26-192.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the small GTPase superfamily. Arf family.Curated

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00550000074639.
HOGENOMiHOG000034025.
HOVERGENiHBG103644.
InParanoidiQ5H913.
KOiK07961.
OMAiNVTIPII.
OrthoDBiEOG7FNC7K.
PhylomeDBiQ5H913.
TreeFamiTF105476.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR024156. Small_GTPase_ARF.
IPR006689. Small_GTPase_ARF/SAR.
[Graphical view]
PfamiPF00025. Arf. 1 hit.
[Graphical view]
PRINTSiPR00328. SAR1GTPBP.
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS51417. ARF. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5H913-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFRLLSSCCS CLRTTEETRR NVTIPIIGLN NSGKTVLVEA FQKLLPSKTD
60 70 80 90 100
HCMKSELTTL LLDEYELSIY DLNGDLKGRE AWPNYYAQAH GLVFVLDSSD
110 120 130 140 150
IRRMQEVKII LTHLLSDKRV AGKPILILAN KQDKKKALMP CDIIDYLLLK
160 170 180 190 200
KLVKENKCPC RVEPCSAIRN LERRNHQPIV EGLRWLLAVI DTCQLPPTSS
210 220 230 240 250
ISISKNNTGS GERCSSHSFS TRTGMSKEKR QHLEQCSIEA KPLKSILQKE
260 270 280 290
GTRLWSKKNM SVTFALDEPM KEGECSRRMR AQNTTKLCYN
Length:290
Mass (Da):33,003
Last modified:October 5, 2010 - v2
Checksum:i56ADA388F7BE747A
GO
Isoform 2 (identifier: Q5H913-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     249-290: KEGTRLWSKKNMSVTFALDEPMKEGECSRRMRAQNTTKLCYN → PSNQSYTH

Note: No experimental confirmation available.

Show »
Length:256
Mass (Da):28,997
Checksum:i4EA22E0767D85001
GO

Sequence cautioni

The sequence CAI42661.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei249 – 29042KEGTR…KLCYN → PSNQSYTH in isoform 2. 1 PublicationVSP_042678Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK301813 mRNA. Translation: BAG63262.1.
Z97985 Genomic DNA. Translation: CAI42661.1. Sequence problems.
BC140808 mRNA. Translation: AAI40809.1.
BC144603 mRNA. Translation: AAI44604.1.
CCDSiCCDS55463.1. [Q5H913-2]
RefSeqiNP_001155963.1. NM_001162491.1. [Q5H913-2]
XP_006724711.1. XM_006724648.1. [Q5H913-1]
UniGeneiHs.147237.

Genome annotation databases

EnsembliENST00000450049; ENSP00000398637; ENSG00000174225. [Q5H913-2]
ENST00000450457; ENSP00000414757; ENSG00000174225. [Q5H913-1]
GeneIDi392509.
KEGGihsa:392509.
UCSCiuc004ego.3. human. [Q5H913-1]
uc010nng.3. human. [Q5H913-2]

Polymorphism databases

DMDMi308153411.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK301813 mRNA. Translation: BAG63262.1 .
Z97985 Genomic DNA. Translation: CAI42661.1 . Sequence problems.
BC140808 mRNA. Translation: AAI40809.1 .
BC144603 mRNA. Translation: AAI44604.1 .
CCDSi CCDS55463.1. [Q5H913-2 ]
RefSeqi NP_001155963.1. NM_001162491.1. [Q5H913-2 ]
XP_006724711.1. XM_006724648.1. [Q5H913-1 ]
UniGenei Hs.147237.

3D structure databases

ProteinModelPortali Q5H913.
SMRi Q5H913. Positions 26-192.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 134249. 4 interactions.
STRINGi 9606.ENSP00000414757.

PTM databases

PhosphoSitei Q5H913.

Polymorphism databases

DMDMi 308153411.

Proteomic databases

PaxDbi Q5H913.
PRIDEi Q5H913.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000450049 ; ENSP00000398637 ; ENSG00000174225 . [Q5H913-2 ]
ENST00000450457 ; ENSP00000414757 ; ENSG00000174225 . [Q5H913-1 ]
GeneIDi 392509.
KEGGi hsa:392509.
UCSCi uc004ego.3. human. [Q5H913-1 ]
uc010nng.3. human. [Q5H913-2 ]

Organism-specific databases

CTDi 392509.
GeneCardsi GC0XP100224.
HGNCi HGNC:31709. ARL13A.
HPAi HPA037377.
HPA037378.
neXtProti NX_Q5H913.
PharmGKBi PA134890660.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1100.
GeneTreei ENSGT00550000074639.
HOGENOMi HOG000034025.
HOVERGENi HBG103644.
InParanoidi Q5H913.
KOi K07961.
OMAi NVTIPII.
OrthoDBi EOG7FNC7K.
PhylomeDBi Q5H913.
TreeFami TF105476.

Miscellaneous databases

GenomeRNAii 392509.
NextBioi 105249.
PROi Q5H913.

Gene expression databases

Bgeei Q5H913.
CleanExi HS_ARL13A.
Genevestigatori Q5H913.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR027417. P-loop_NTPase.
IPR024156. Small_GTPase_ARF.
IPR006689. Small_GTPase_ARF/SAR.
[Graphical view ]
Pfami PF00025. Arf. 1 hit.
[Graphical view ]
PRINTSi PR00328. SAR1GTPBP.
SUPFAMi SSF52540. SSF52540. 1 hit.
PROSITEi PS51417. ARF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiAR13A_HUMAN
AccessioniPrimary (citable) accession number: Q5H913
Secondary accession number(s): B2RTT6, B4DX50
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: October 5, 2010
Last modified: October 29, 2014
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3