Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5H913

- AR13A_HUMAN

UniProt

Q5H913 - AR13A_HUMAN

Protein

ADP-ribosylation factor-like protein 13A

Gene

ARL13A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 88 (01 Oct 2014)
      Sequence version 2 (05 Oct 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi28 – 358GTPBy similarity
    Nucleotide bindingi71 – 755GTPBy similarity
    Nucleotide bindingi130 – 1334GTPBy similarity

    GO - Molecular functioni

    1. GTP binding Source: UniProtKB-KW

    GO - Biological processi

    1. small GTPase mediated signal transduction Source: InterPro

    Keywords - Ligandi

    GTP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    ADP-ribosylation factor-like protein 13A
    Gene namesi
    Name:ARL13A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:31709. ARL13A.

    Subcellular locationi

    GO - Cellular componenti

    1. intracellular Source: InterPro

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134890660.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 290290ADP-ribosylation factor-like protein 13APRO_0000284145Add
    BLAST

    Proteomic databases

    PaxDbiQ5H913.
    PRIDEiQ5H913.

    PTM databases

    PhosphoSiteiQ5H913.

    Expressioni

    Gene expression databases

    BgeeiQ5H913.
    CleanExiHS_ARL13A.
    GenevestigatoriQ5H913.

    Organism-specific databases

    HPAiHPA037377.
    HPA037378.

    Interactioni

    Protein-protein interaction databases

    BioGridi134249. 4 interactions.
    STRINGi9606.ENSP00000414757.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5H913.
    SMRiQ5H913. Positions 26-192.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the small GTPase superfamily. Arf family.Curated

    Phylogenomic databases

    eggNOGiCOG1100.
    HOGENOMiHOG000034025.
    HOVERGENiHBG103644.
    InParanoidiQ5H913.
    KOiK07961.
    OMAiNVTIPII.
    OrthoDBiEOG7FNC7K.
    PhylomeDBiQ5H913.
    TreeFamiTF105476.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR027417. P-loop_NTPase.
    IPR024156. Small_GTPase_ARF.
    IPR006689. Small_GTPase_ARF/SAR.
    [Graphical view]
    PfamiPF00025. Arf. 1 hit.
    [Graphical view]
    PRINTSiPR00328. SAR1GTPBP.
    SUPFAMiSSF52540. SSF52540. 1 hit.
    PROSITEiPS51417. ARF. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5H913-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFRLLSSCCS CLRTTEETRR NVTIPIIGLN NSGKTVLVEA FQKLLPSKTD    50
    HCMKSELTTL LLDEYELSIY DLNGDLKGRE AWPNYYAQAH GLVFVLDSSD 100
    IRRMQEVKII LTHLLSDKRV AGKPILILAN KQDKKKALMP CDIIDYLLLK 150
    KLVKENKCPC RVEPCSAIRN LERRNHQPIV EGLRWLLAVI DTCQLPPTSS 200
    ISISKNNTGS GERCSSHSFS TRTGMSKEKR QHLEQCSIEA KPLKSILQKE 250
    GTRLWSKKNM SVTFALDEPM KEGECSRRMR AQNTTKLCYN 290
    Length:290
    Mass (Da):33,003
    Last modified:October 5, 2010 - v2
    Checksum:i56ADA388F7BE747A
    GO
    Isoform 2 (identifier: Q5H913-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         249-290: KEGTRLWSKKNMSVTFALDEPMKEGECSRRMRAQNTTKLCYN → PSNQSYTH

    Note: No experimental confirmation available.

    Show »
    Length:256
    Mass (Da):28,997
    Checksum:i4EA22E0767D85001
    GO

    Sequence cautioni

    The sequence CAI42661.1 differs from that shown. Reason: Erroneous gene model prediction.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei249 – 29042KEGTR…KLCYN → PSNQSYTH in isoform 2. 1 PublicationVSP_042678Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK301813 mRNA. Translation: BAG63262.1.
    Z97985 Genomic DNA. Translation: CAI42661.1. Sequence problems.
    BC140808 mRNA. Translation: AAI40809.1.
    BC144603 mRNA. Translation: AAI44604.1.
    CCDSiCCDS55463.1. [Q5H913-2]
    RefSeqiNP_001155963.1. NM_001162491.1. [Q5H913-2]
    XP_006724711.1. XM_006724648.1. [Q5H913-1]
    UniGeneiHs.147237.

    Genome annotation databases

    EnsembliENST00000450049; ENSP00000398637; ENSG00000174225. [Q5H913-2]
    ENST00000450457; ENSP00000414757; ENSG00000174225. [Q5H913-1]
    GeneIDi392509.
    KEGGihsa:392509.
    UCSCiuc004ego.3. human. [Q5H913-1]
    uc010nng.3. human. [Q5H913-2]

    Polymorphism databases

    DMDMi308153411.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK301813 mRNA. Translation: BAG63262.1 .
    Z97985 Genomic DNA. Translation: CAI42661.1 . Sequence problems.
    BC140808 mRNA. Translation: AAI40809.1 .
    BC144603 mRNA. Translation: AAI44604.1 .
    CCDSi CCDS55463.1. [Q5H913-2 ]
    RefSeqi NP_001155963.1. NM_001162491.1. [Q5H913-2 ]
    XP_006724711.1. XM_006724648.1. [Q5H913-1 ]
    UniGenei Hs.147237.

    3D structure databases

    ProteinModelPortali Q5H913.
    SMRi Q5H913. Positions 26-192.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 134249. 4 interactions.
    STRINGi 9606.ENSP00000414757.

    PTM databases

    PhosphoSitei Q5H913.

    Polymorphism databases

    DMDMi 308153411.

    Proteomic databases

    PaxDbi Q5H913.
    PRIDEi Q5H913.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000450049 ; ENSP00000398637 ; ENSG00000174225 . [Q5H913-2 ]
    ENST00000450457 ; ENSP00000414757 ; ENSG00000174225 . [Q5H913-1 ]
    GeneIDi 392509.
    KEGGi hsa:392509.
    UCSCi uc004ego.3. human. [Q5H913-1 ]
    uc010nng.3. human. [Q5H913-2 ]

    Organism-specific databases

    CTDi 392509.
    GeneCardsi GC0XP100224.
    HGNCi HGNC:31709. ARL13A.
    HPAi HPA037377.
    HPA037378.
    neXtProti NX_Q5H913.
    PharmGKBi PA134890660.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1100.
    HOGENOMi HOG000034025.
    HOVERGENi HBG103644.
    InParanoidi Q5H913.
    KOi K07961.
    OMAi NVTIPII.
    OrthoDBi EOG7FNC7K.
    PhylomeDBi Q5H913.
    TreeFami TF105476.

    Miscellaneous databases

    GenomeRNAii 392509.
    NextBioi 105249.
    PROi Q5H913.

    Gene expression databases

    Bgeei Q5H913.
    CleanExi HS_ARL13A.
    Genevestigatori Q5H913.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR027417. P-loop_NTPase.
    IPR024156. Small_GTPase_ARF.
    IPR006689. Small_GTPase_ARF/SAR.
    [Graphical view ]
    Pfami PF00025. Arf. 1 hit.
    [Graphical view ]
    PRINTSi PR00328. SAR1GTPBP.
    SUPFAMi SSF52540. SSF52540. 1 hit.
    PROSITEi PS51417. ARF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    2. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.

    Entry informationi

    Entry nameiAR13A_HUMAN
    AccessioniPrimary (citable) accession number: Q5H913
    Secondary accession number(s): B2RTT6, B4DX50
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 17, 2007
    Last sequence update: October 5, 2010
    Last modified: October 1, 2014
    This is version 88 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3