Q5H8C1 (FREM1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: FRAS1-related extracellular matrix protein 1 Alternative name(s): Protein QBRICK | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2179 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Extracellular matrix protein that plays a role in epidermal differentiation and is required for epidermal adhesion during embryonic development By similarity. |
| Subcellular location | Secreted › extracellular space › extracellular matrix › basement membrane By similarity. Note: Localizes at the basement membrane zone of embryonic epidermis and hair follicles By similarity. |
| Domain | The Calx-beta domain binds calcium with high affinity and undergo a major conformational shift upon binding By similarity. |
| Involvement in disease | Bifid nose, with or without anorectal and renal anomalies (BNAR) [MIM:608980]: A disease characterized by the presence of a bifid nose usually associated with renal agenesis and anorectal malformations. A bifid nose is a congenital deformity due to failure of the paired nasal processes to fuse to a single midline organ during early gestation. Manitoba oculotrichoanal syndrome (MOTA) [MIM:248450]: A rare condition defined by eyelid colobomas, cryptophthalmos, and anophthalmia/microphthalmia, an aberrant hairline, a bifid or broad nasal tip, and gastrointestinal anomalies such as omphalocele and anal stenosis. Trigonocephaly 2 (TRIGNO2) [MIM:614485]: A keel-shaped deformation of the forehead, caused by premature fusion of the metopic sutures. It results in a triangular shape of the head. |
| Miscellaneous | Was termed QBRICK because it contains 12 repeats: 'Q' stands for queen and is taken from the queen being the 12th in a suit of playing card, and 'BRICK' stands for the repeating unit. |
| Sequence similarities | Belongs to the FRAS1 family. Contains 1 C-type lectin domain. Contains 1 Calx-beta domain. Contains 12 CSPG (NG2) repeats. |
| Sequence caution | The sequence CAH71826.2 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5H8C1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5H8C1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1470: Missing. 1471-1480: SKVTVSSDRF → MLKAALPLFT | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q5H8C1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1803: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q5H8C1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1587: Missing. 1588-1619: TDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQ → MLDESLAVRRSKKCKEMIMHWEKKEDIDIVNT 1804-1809: MSTKMW → SSILCL 1810-2179: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Potential | ||||||||
| Chain | 22 – 2179 | 2158 | FRAS1-related extracellular matrix protein 1 | PRO_0000010122 | |||||||
Regions | |||||||||||
| Repeat | 275 – 394 | 120 | CSPG 1 | ||||||||
| Repeat | 395 – 502 | 108 | CSPG 2 | ||||||||
| Repeat | 503 – 621 | 119 | CSPG 3 | ||||||||
| Repeat | 622 – 758 | 137 | CSPG 4 | ||||||||
| Repeat | 759 – 869 | 111 | CSPG 5 | ||||||||
| Repeat | 870 – 1005 | 136 | CSPG 6 | ||||||||
| Repeat | 1006 – 1129 | 124 | CSPG 7 | ||||||||
| Repeat | 1130 – 1256 | 127 | CSPG 8 | ||||||||
| Repeat | 1257 – 1375 | 119 | CSPG 9 | ||||||||
| Repeat | 1376 – 1487 | 112 | CSPG 10 | ||||||||
| Repeat | 1488 – 1608 | 121 | CSPG 11 | ||||||||
| Repeat | 1609 – 1729 | 121 | CSPG 12 | ||||||||
| Domain | 1731 – 1830 | 100 | Calx-beta | ||||||||
| Domain | 2060 – 2174 | 115 | C-type lectin | ||||||||
| Motif | 199 – 201 | 3 | Cell attachment site By similarity | ||||||||
| Motif | 1907 – 1909 | 3 | Cell attachment site Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 335 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 560 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 622 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1014 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1566 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 2151 ↔ 2165 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 1803 | 1803 | Missing in isoform 3. | VSP_015025 | |||||||
| Alternative sequence | 1 – 1587 | 1587 | Missing in isoform 4. | VSP_015026 | |||||||
| Alternative sequence | 1 – 1470 | 1470 | Missing in isoform 2. | VSP_015027 | |||||||
| Alternative sequence | 1471 – 1480 | 10 | SKVTVSSDRF → MLKAALPLFT in isoform 2. | VSP_015028 | |||||||
| Alternative sequence | 1588 – 1619 | 32 | TDCFT…LFTIQ → MLDESLAVRRSKKCKEMIMH WEKKEDIDIVNT in isoform 4. | VSP_015029 | |||||||
| Alternative sequence | 1804 – 1809 | 6 | MSTKMW → SSILCL in isoform 4. | VSP_015030 | |||||||
| Alternative sequence | 1810 – 2179 | 370 | Missing in isoform 4. | VSP_015031 | |||||||
| Natural variant | 439 | 1 | V → L. Ref.1 Corresponds to variant rs2779500 [ dbSNP | Ensembl ]. | VAR_047317 | |||||||
| Natural variant | 498 | 1 | R → Q in TRIGNO2. Ref.8 | VAR_067916 | |||||||
| Natural variant | 499 | 1 | I → V. Corresponds to variant rs1353223 [ dbSNP | Ensembl ]. | VAR_047318 | |||||||
| Natural variant | 649 | 1 | R → W in BNAR. Ref.6 | VAR_063422 | |||||||
| Natural variant | 803 | 1 | S → Y. Corresponds to variant rs7023244 [ dbSNP | Ensembl ]. | VAR_047319 | |||||||
| Natural variant | 863 | 1 | L → V. Ref.1 Corresponds to variant rs7041710 [ dbSNP | Ensembl ]. | VAR_047320 | |||||||
| Natural variant | 1202 | 1 | S → R. Corresponds to variant rs16932300 [ dbSNP | Ensembl ]. | VAR_047321 | |||||||
| Natural variant | 1273 | 1 | D → E. Corresponds to variant rs7025814 [ dbSNP | Ensembl ]. | VAR_047322 | |||||||
| Natural variant | 1324 | 1 | L → R in MOTA. Ref.7 | VAR_066412 | |||||||
| Natural variant | 1440 | 1 | G → S in BNAR. Ref.6 | VAR_063423 | |||||||
| Natural variant | 1500 | 1 | E → V in TRIGNO2. Ref.8 | VAR_067917 | |||||||
| Natural variant | 1502 | 1 | V → M. Corresponds to variant rs10961700 [ dbSNP | Ensembl ]. | VAR_047323 | |||||||
| Natural variant | 1576 | 1 | N → I. Corresponds to variant rs2101770 [ dbSNP | Ensembl ]. | VAR_047324 | |||||||
| Natural variant | 2091 | 1 | V → I in MOTA. Ref.7 | VAR_066413 | |||||||
| Natural variant | 2143 | 1 | Q → P. Ref.1 Ref.5 Corresponds to variant rs10961689 [ dbSNP | Ensembl ]. | VAR_047325 | |||||||
| Natural variant | 2174 | 1 | V → G. Ref.5 Corresponds to variant rs17856912 [ dbSNP | Ensembl ]. | VAR_047326 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 1735 | 1 | I → N in AAH31064. Ref.5 | ||||||||
| Sequence conflict | 1861 | 1 | S → A in CAE46048. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Web resources
| Mendelian genes FRAS1 related extracellular matrix 1 (FREM1) Leiden Open Variation Database (LOVD) |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB160987 mRNA. Translation: BAD89015.1. AK058190 mRNA. Translation: BAB71709.1. BX641104 mRNA. Translation: CAE46048.1. AL354672 Genomic DNA. No translation available. AL512643, AL390732 Genomic DNA. Translation: CAH71826.2. Sequence problems. AL390732, AL512643 Genomic DNA. Translation: CAH73848.1. BC031064 mRNA. Translation: AAH31064.2. |
| IPI | IPI00186984. IPI00477820. IPI00645359. IPI00922794. |
| RefSeq | NP_001171175.1. NM_001177704.1. NP_659403.4. NM_144966.5. |
| UniGene | Hs.50850. |
3D structure databases | |
| ProteinModelPortal | Q5H8C1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000413394. |
PTM databases | |
| PhosphoSite | Q5H8C1. |
Polymorphism databases | |
| DMDM | 215274141. |
Proteomic databases | |
| PaxDb | Q5H8C1. |
| PRIDE | Q5H8C1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000380880; ENSP00000370262; ENSG00000164946. ENST00000422223; ENSP00000412940; ENSG00000164946. ENST00000427623; ENSP00000412597; ENSG00000164946. |
| GeneID | 158326. |
| KEGG | hsa:158326. |
| UCSC | uc003zlm.3. human. |
Organism-specific databases | |
| CTD | 158326. |
| GeneCards | GC09M014730. |
| HGNC | HGNC:23399. FREM1. |
| MIM | 248450. phenotype. 608944. gene. 608980. phenotype. 614485. phenotype. |
| neXtProt | NX_Q5H8C1. |
| Orphanet | 217266. BNAR syndrome. 3366. Isolated trigonocephaly. 2717. Oculotrichoanal syndrome. |
| PharmGKB | PA134892147. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG12793. |
| HOGENOM | HOG000231310. |
| HOVERGEN | HBG080222. |
| InParanoid | Q5H8C1. |
Gene expression databases | |
| ArrayExpress | Q5H8C1. |
| Bgee | Q5H8C1. |
| CleanEx | HS_FREM1. |
| Genevestigator | Q5H8C1. |
| GermOnline | ENSG00000164946. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.10.100.10. 1 hit. |
| InterPro | IPR001304. C-type_lectin. IPR016186. C-type_lectin-like. IPR016187. C-type_lectin_fold. IPR003644. Calx_beta. [Graphical view] |
| Pfam | PF03160. Calx-beta. 1 hit. PF00059. Lectin_C. 1 hit. [Graphical view] |
| SMART | SM00034. CLECT. 1 hit. [Graphical view] |
| SUPFAM | SSF56436. C-type_lectin_fold. 1 hit. |
| PROSITE | PS00615. C_TYPE_LECTIN_1. False negative. PS50041. C_TYPE_LECTIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 158326. |
| NextBio | 87697. |
| SOURCE | Search... |
Entry information
| Entry name | FREM1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5H8C1 Secondary accession number(s): Q5VV00 Q96LI3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
