Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5H8A4

- PIGG_HUMAN

UniProt

Q5H8A4 - PIGG_HUMAN

Protein

GPI ethanolamine phosphate transferase 2

Gene

PIGG

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 82 (01 Oct 2014)
      Sequence version 1 (01 Mar 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers ethanolamine phosphate to the GPI second mannose.1 Publication

    Pathwayi

    GO - Molecular functioni

    1. CP2 mannose-ethanolamine phosphotransferase activity Source: MGI
    2. phosphotransferase activity, for other substituted phosphate groups Source: Reactome

    GO - Biological processi

    1. cellular protein metabolic process Source: Reactome
    2. C-terminal protein lipidation Source: Reactome
    3. GPI anchor biosynthetic process Source: MGI
    4. post-translational protein modification Source: Reactome
    5. preassembly of GPI anchor in ER membrane Source: Reactome

    Keywords - Molecular functioni

    Transferase

    Keywords - Biological processi

    GPI-anchor biosynthesis

    Enzyme and pathway databases

    ReactomeiREACT_952. Synthesis of glycosylphosphatidylinositol (GPI).
    UniPathwayiUPA00196.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    GPI ethanolamine phosphate transferase 2 (EC:2.-.-.-)
    Alternative name(s):
    GPI7 homolog
    Short name:
    hGPI7
    Phosphatidylinositol-glycan biosynthesis class G protein
    Short name:
    PIG-G
    Gene namesi
    Name:PIGG
    Synonyms:GPI7
    ORF Names:UNQ1930/PRO4405
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:25985. PIGG.

    Subcellular locationi

    Endoplasmic reticulum membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. endoplasmic reticulum Source: MGI
    2. endoplasmic reticulum membrane Source: Reactome
    3. integral component of membrane Source: UniProtKB-KW
    4. membrane Source: UniProtKB

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA143485575.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 983983GPI ethanolamine phosphate transferase 2PRO_0000246185Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi194 – 1941N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ5H8A4.
    PaxDbiQ5H8A4.
    PRIDEiQ5H8A4.

    PTM databases

    PhosphoSiteiQ5H8A4.

    Expressioni

    Gene expression databases

    ArrayExpressiQ5H8A4.
    BgeeiQ5H8A4.
    CleanExiHS_PIGG.
    GenevestigatoriQ5H8A4.

    Organism-specific databases

    HPAiHPA015997.

    Interactioni

    Subunit structurei

    Forms a complex with PIGF. PIGF is required to stabilize it. Competes with PIGO for the binding of PIGF.

    Protein-protein interaction databases

    BioGridi120220. 5 interactions.
    MINTiMINT-3042035.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5H8A4.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 431431LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei432 – 45221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei471 – 49121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei506 – 52621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei552 – 57221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei699 – 71921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei721 – 74121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei752 – 77221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei789 – 80921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei812 – 83221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei879 – 89921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei919 – 93921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei955 – 97521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the PIGG/PIGN/PIGO family. PIGG subfamily.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1524.
    HOVERGENiHBG075245.
    InParanoidiQ5H8A4.
    KOiK05310.
    OMAiQTWYFLV.
    OrthoDBiEOG7B8S35.
    PhylomeDBiQ5H8A4.
    TreeFamiTF300609.

    Family and domain databases

    Gene3Di3.40.720.10. 1 hit.
    InterProiIPR017849. Alkaline_Pase-like_a/b/a.
    IPR017850. Alkaline_phosphatase_core.
    IPR002591. Phosphodiest/P_Trfase.
    [Graphical view]
    PfamiPF01663. Phosphodiest. 1 hit.
    [Graphical view]
    SUPFAMiSSF53649. SSF53649. 1 hit.

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5H8A4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRLGSGTFAT CCVAIEVLGI AVFLRGFFPA PVRSSARAEH GAEPPAPEPS    50
    AGASSNWTTL PPPLFSKVVI VLIDALRDDF VFGSKGVKFM PYTTYLVEKG 100
    ASHSFVAEAK PPTVTMPRIK ALMTGSLPGF VDVIRNLNSP ALLEDSVIRQ 150
    AKAAGKRIVF YGDETWVKLF PKHFVEYDGT TSFFVSDYTE VDNNVTRHLD 200
    KVLKRGDWDI LILHYLGLDH IGHISGPNSP LIGQKLSEMD SVLMKIHTSL 250
    QSKERETPLP NLLVLCGDHG MSETGSHGAS STEEVNTPLI LISSAFERKP 300
    GDIRHPKHVQ QTDVAATLAI ALGLPIPKDS VGSLLFPVVE GRPMREQLRF 350
    LHLNTVQLSK LLQENVPSYE KDPGFEQFKM SERLHGNWIR LYLEEKHSEV 400
    LFNLGSKVLR QYLDALKTLS LSLSAQVAQY DIYSMMVGTV VVLEVLTLLL 450
    LSVPQALRRK AELEVPLSSP GFSLLFYLVI LVLSAVHVIV CTSAESSCYF 500
    CGLSWLAAGG VMVLASALLC VIVSVLTNVL VGGNTPRKNP MHPSSRWSEL 550
    DLLILLGTAG HVLSLGASSF VEEEHQTWYF LVNTLCLALS QETYRNYFLG 600
    DDGEPPCGLC VEQGHDGATA AWQDGPGCDV LERDKGHGSP STSEVLRGRE 650
    KWMVLASPWL ILACCRLLRS LNQTGVQWAH RPDLGHWLTS SDHKAELSVL 700
    AALSLLVVFV LVQRGCSPVS KAALALGLLG VYCYRAAIGS VRFPWRPDSK 750
    DISKGIIEAR FVYVFVLGIL FTGTKDLLKS QVIAADFKLK TVGLWEIYSG 800
    LVLLAALLFR PHNLPVLAFS LLIQTLMTKF IWKPLRHDAA EITVMHYWFG 850
    QAFFYFQGNS NNIATVDISA GFVGLDTYVE IPAVLLTAFG TYAGPVLWAS 900
    HLVHFLSSET RSGSALSHAC FCYALICSIP VFTYIVLVTS LRYHLFIWSV 950
    FSPKLLYEGM HLLITAAVCV FFTAMDQTRL TQS 983
    Length:983
    Mass (Da):108,173
    Last modified:March 1, 2005 - v1
    Checksum:i18D5DF737B000D2D
    GO
    Isoform 2 (identifier: Q5H8A4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         437-444: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:975
    Mass (Da):107,376
    Checksum:i1D597136E243863E
    GO
    Isoform 3 (identifier: Q5H8A4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         120-252: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:850
    Mass (Da):93,251
    Checksum:i731AF8C6140D36C0
    GO
    Isoform 4 (identifier: Q5H8A4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         430-463: YDIYSMMVGTVVVLEVLTLLLLSVPQALRRKAEL → FSPCSCSASHRHCTERLSWKSHCHLLGFLCSFIW
         464-983: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:463
    Mass (Da):51,267
    Checksum:i02EDEEBFE96AC294
    GO
    Isoform 5 (identifier: Q5H8A4-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-89: Missing.
         372-388: DPGFEQFKMSERLHGNW → GSHPAPAQRPTGTAQKG
         389-983: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:299
    Mass (Da):32,913
    Checksum:i73D96DB53EA11006
    GO
    Isoform 6 (identifier: Q5H8A4-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-122: Missing.
         430-463: YDIYSMMVGTVVVLEVLTLLLLSVPQALRRKAEL → FSPCSCSASHRHCAERLSWKSHCHLLGFLCSFIW
         464-983: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:341
    Mass (Da):38,290
    Checksum:i9DC3B4F0B1EC6633
    GO

    Sequence cautioni

    The sequence BAA91046.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB55130.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAQ88902.1 differs from that shown. Reason: Erroneous termination at position 311. Translated as Gln.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti624 – 6241D → G in BAC11227. (PubMed:16303743)Curated
    Sequence conflicti889 – 8891F → L in BAC11227. (PubMed:16303743)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti55 – 551S → Y.
    Corresponds to variant rs34120878 [ dbSNP | Ensembl ].
    VAR_057680
    Natural varianti458 – 4581R → H.1 Publication
    Corresponds to variant rs13115344 [ dbSNP | Ensembl ].
    VAR_027022
    Natural varianti610 – 6101C → R.1 Publication
    Corresponds to variant rs7666425 [ dbSNP | Ensembl ].
    VAR_027023
    Natural varianti699 – 6991V → I.2 Publications
    Corresponds to variant rs13114026 [ dbSNP | Ensembl ].
    VAR_027024
    Natural varianti731 – 7311V → I.
    Corresponds to variant rs34916638 [ dbSNP | Ensembl ].
    VAR_060086
    Natural varianti881 – 8811I → T.
    Corresponds to variant rs34623004 [ dbSNP | Ensembl ].
    VAR_060087
    Natural varianti932 – 9321F → S.
    Corresponds to variant rs1127410 [ dbSNP | Ensembl ].
    VAR_027025

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 122122Missing in isoform 6. 1 PublicationVSP_054387Add
    BLAST
    Alternative sequencei1 – 8989Missing in isoform 5. 1 PublicationVSP_019827Add
    BLAST
    Alternative sequencei120 – 252133Missing in isoform 3. 1 PublicationVSP_019828Add
    BLAST
    Alternative sequencei372 – 38817DPGFE…LHGNW → GSHPAPAQRPTGTAQKG in isoform 5. 1 PublicationVSP_019829Add
    BLAST
    Alternative sequencei389 – 983595Missing in isoform 5. 1 PublicationVSP_019830Add
    BLAST
    Alternative sequencei430 – 46334YDIYS…RKAEL → FSPCSCSASHRHCTERLSWK SHCHLLGFLCSFIW in isoform 4. 1 PublicationVSP_019831Add
    BLAST
    Alternative sequencei430 – 46334YDIYS…RKAEL → FSPCSCSASHRHCAERLSWK SHCHLLGFLCSFIW in isoform 6. 1 PublicationVSP_054388Add
    BLAST
    Alternative sequencei437 – 4448Missing in isoform 2. 1 PublicationVSP_019832
    Alternative sequencei464 – 983520Missing in isoform 4 and isoform 6. 2 PublicationsVSP_019833Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB162713 mRNA. Translation: BAD89023.1.
    AY358538 mRNA. Translation: AAQ88902.1. Sequence problems.
    AK074815 mRNA. Translation: BAC11227.1.
    AK000272 mRNA. Translation: BAA91046.1. Different initiation.
    AK027465 mRNA. Translation: BAB55130.1. Different initiation.
    AK097244 mRNA. Translation: BAC04984.1.
    AK296507 mRNA. Translation: BAG59139.1.
    AC092574 Genomic DNA. No translation available.
    AC116565 Genomic DNA. No translation available.
    BC000937 mRNA. Translation: AAH00937.2.
    BC001249 mRNA. Translation: AAH01249.2.
    BC110878 mRNA. Translation: AAI10879.1.
    CCDSiCCDS3336.1. [Q5H8A4-2]
    CCDS46992.1. [Q5H8A4-1]
    RefSeqiNP_001120650.1. NM_001127178.2. [Q5H8A4-1]
    NP_001275980.1. NM_001289051.1.
    NP_001275981.1. NM_001289052.1. [Q5H8A4-3]
    NP_001275984.1. NM_001289055.1. [Q5H8A4-6]
    NP_001275986.1. NM_001289057.1. [Q5H8A4-5]
    NP_060203.3. NM_017733.4. [Q5H8A4-2]
    UniGeneiHs.7099.

    Genome annotation databases

    EnsembliENST00000310340; ENSP00000311750; ENSG00000174227. [Q5H8A4-2]
    ENST00000383028; ENSP00000372494; ENSG00000174227. [Q5H8A4-3]
    ENST00000453061; ENSP00000415203; ENSG00000174227. [Q5H8A4-1]
    ENST00000503111; ENSP00000426002; ENSG00000174227. [Q5H8A4-5]
    GeneIDi54872.
    KEGGihsa:54872.
    UCSCiuc003gaj.4. human. [Q5H8A4-2]
    uc003gak.4. human. [Q5H8A4-1]
    uc003gam.3. human. [Q5H8A4-5]
    uc010ibf.3. human. [Q5H8A4-3]

    Polymorphism databases

    DMDMi74707851.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB162713 mRNA. Translation: BAD89023.1 .
    AY358538 mRNA. Translation: AAQ88902.1 . Sequence problems.
    AK074815 mRNA. Translation: BAC11227.1 .
    AK000272 mRNA. Translation: BAA91046.1 . Different initiation.
    AK027465 mRNA. Translation: BAB55130.1 . Different initiation.
    AK097244 mRNA. Translation: BAC04984.1 .
    AK296507 mRNA. Translation: BAG59139.1 .
    AC092574 Genomic DNA. No translation available.
    AC116565 Genomic DNA. No translation available.
    BC000937 mRNA. Translation: AAH00937.2 .
    BC001249 mRNA. Translation: AAH01249.2 .
    BC110878 mRNA. Translation: AAI10879.1 .
    CCDSi CCDS3336.1. [Q5H8A4-2 ]
    CCDS46992.1. [Q5H8A4-1 ]
    RefSeqi NP_001120650.1. NM_001127178.2. [Q5H8A4-1 ]
    NP_001275980.1. NM_001289051.1.
    NP_001275981.1. NM_001289052.1. [Q5H8A4-3 ]
    NP_001275984.1. NM_001289055.1. [Q5H8A4-6 ]
    NP_001275986.1. NM_001289057.1. [Q5H8A4-5 ]
    NP_060203.3. NM_017733.4. [Q5H8A4-2 ]
    UniGenei Hs.7099.

    3D structure databases

    ProteinModelPortali Q5H8A4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120220. 5 interactions.
    MINTi MINT-3042035.

    PTM databases

    PhosphoSitei Q5H8A4.

    Polymorphism databases

    DMDMi 74707851.

    Proteomic databases

    MaxQBi Q5H8A4.
    PaxDbi Q5H8A4.
    PRIDEi Q5H8A4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000310340 ; ENSP00000311750 ; ENSG00000174227 . [Q5H8A4-2 ]
    ENST00000383028 ; ENSP00000372494 ; ENSG00000174227 . [Q5H8A4-3 ]
    ENST00000453061 ; ENSP00000415203 ; ENSG00000174227 . [Q5H8A4-1 ]
    ENST00000503111 ; ENSP00000426002 ; ENSG00000174227 . [Q5H8A4-5 ]
    GeneIDi 54872.
    KEGGi hsa:54872.
    UCSCi uc003gaj.4. human. [Q5H8A4-2 ]
    uc003gak.4. human. [Q5H8A4-1 ]
    uc003gam.3. human. [Q5H8A4-5 ]
    uc010ibf.3. human. [Q5H8A4-3 ]

    Organism-specific databases

    CTDi 54872.
    GeneCardsi GC04P000486.
    HGNCi HGNC:25985. PIGG.
    HPAi HPA015997.
    neXtProti NX_Q5H8A4.
    PharmGKBi PA143485575.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1524.
    HOVERGENi HBG075245.
    InParanoidi Q5H8A4.
    KOi K05310.
    OMAi QTWYFLV.
    OrthoDBi EOG7B8S35.
    PhylomeDBi Q5H8A4.
    TreeFami TF300609.

    Enzyme and pathway databases

    UniPathwayi UPA00196 .
    Reactomei REACT_952. Synthesis of glycosylphosphatidylinositol (GPI).

    Miscellaneous databases

    GenomeRNAii 54872.
    NextBioi 35472752.
    PROi Q5H8A4.

    Gene expression databases

    ArrayExpressi Q5H8A4.
    Bgeei Q5H8A4.
    CleanExi HS_PIGG.
    Genevestigatori Q5H8A4.

    Family and domain databases

    Gene3Di 3.40.720.10. 1 hit.
    InterProi IPR017849. Alkaline_Pase-like_a/b/a.
    IPR017850. Alkaline_phosphatase_core.
    IPR002591. Phosphodiest/P_Trfase.
    [Graphical view ]
    Pfami PF01663. Phosphodiest. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53649. SSF53649. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "GPI7 is the second partner of PIG-F and involved in modification of glycosylphosphatidylinositol."
      Shishioh N., Hong Y., Ohishi K., Ashida H., Maeda Y., Kinoshita T.
      J. Biol. Chem. 280:9728-9734(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH PIGF.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    3. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
      Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
      , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
      DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 367-983 (ISOFORM 1), VARIANT ILE-699.
      Tissue: Cervix, Colon mucosa, Teratocarcinoma and Thalamus.
    5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANTS HIS-458; ARG-610 AND ILE-699.
      Tissue: Lung and Placenta.

    Entry informationi

    Entry nameiPIGG_HUMAN
    AccessioniPrimary (citable) accession number: Q5H8A4
    Secondary accession number(s): B4DKC7
    , Q2TAK5, Q6UX31, Q7L5Y4, Q8N866, Q8NCC9, Q96SY9, Q9BVT7, Q9NXG5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 25, 2006
    Last sequence update: March 1, 2005
    Last modified: October 1, 2014
    This is version 82 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3