SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5H8A4

- PIGG_HUMAN

UniProt

Q5H8A4 - PIGG_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

GPI ethanolamine phosphate transferase 2

Gene
PIGG, GPI7, UNQ1930/PRO4405
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers ethanolamine phosphate to the GPI second mannose.1 Publication

Pathwayi

GO - Molecular functioni

  1. CP2 mannose-ethanolamine phosphotransferase activity Source: MGI
  2. phosphotransferase activity, for other substituted phosphate groups Source: Reactome

GO - Biological processi

  1. cellular protein metabolic process Source: Reactome
  2. C-terminal protein lipidation Source: Reactome
  3. GPI anchor biosynthetic process Source: MGI
  4. post-translational protein modification Source: Reactome
  5. preassembly of GPI anchor in ER membrane Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

GPI-anchor biosynthesis

Enzyme and pathway databases

ReactomeiREACT_952. Synthesis of glycosylphosphatidylinositol (GPI).
UniPathwayiUPA00196.

Names & Taxonomyi

Protein namesi
Recommended name:
GPI ethanolamine phosphate transferase 2 (EC:2.-.-.-)
Alternative name(s):
GPI7 homolog
Short name:
hGPI7
Phosphatidylinositol-glycan biosynthesis class G protein
Short name:
PIG-G
Gene namesi
Name:PIGG
Synonyms:GPI7
ORF Names:UNQ1930/PRO4405
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:25985. PIGG.

Subcellular locationi

Endoplasmic reticulum membrane; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 431431Lumenal Reviewed predictionAdd
BLAST
Transmembranei432 – 45221Helical; Reviewed predictionAdd
BLAST
Transmembranei471 – 49121Helical; Reviewed predictionAdd
BLAST
Transmembranei506 – 52621Helical; Reviewed predictionAdd
BLAST
Transmembranei552 – 57221Helical; Reviewed predictionAdd
BLAST
Transmembranei699 – 71921Helical; Reviewed predictionAdd
BLAST
Transmembranei721 – 74121Helical; Reviewed predictionAdd
BLAST
Transmembranei752 – 77221Helical; Reviewed predictionAdd
BLAST
Transmembranei789 – 80921Helical; Reviewed predictionAdd
BLAST
Transmembranei812 – 83221Helical; Reviewed predictionAdd
BLAST
Transmembranei879 – 89921Helical; Reviewed predictionAdd
BLAST
Transmembranei919 – 93921Helical; Reviewed predictionAdd
BLAST
Transmembranei955 – 97521Helical; Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum Source: MGI
  2. endoplasmic reticulum membrane Source: Reactome
  3. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485575.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 983983GPI ethanolamine phosphate transferase 2PRO_0000246185Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi194 – 1941N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ5H8A4.
PaxDbiQ5H8A4.
PRIDEiQ5H8A4.

PTM databases

PhosphoSiteiQ5H8A4.

Expressioni

Gene expression databases

ArrayExpressiQ5H8A4.
BgeeiQ5H8A4.
CleanExiHS_PIGG.
GenevestigatoriQ5H8A4.

Organism-specific databases

HPAiHPA015997.

Interactioni

Subunit structurei

Forms a complex with PIGF. PIGF is required to stabilize it. Competes with PIGO for the binding of PIGF.

Protein-protein interaction databases

BioGridi120220. 5 interactions.
MINTiMINT-3042035.

Structurei

3D structure databases

ProteinModelPortaliQ5H8A4.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1524.
HOVERGENiHBG075245.
InParanoidiQ5H8A4.
KOiK05310.
OMAiQTWYFLV.
OrthoDBiEOG7B8S35.
PhylomeDBiQ5H8A4.
TreeFamiTF300609.

Family and domain databases

Gene3Di3.40.720.10. 1 hit.
InterProiIPR017849. Alkaline_Pase-like_a/b/a.
IPR017850. Alkaline_phosphatase_core.
IPR002591. Phosphodiest/P_Trfase.
[Graphical view]
PfamiPF01663. Phosphodiest. 1 hit.
[Graphical view]
SUPFAMiSSF53649. SSF53649. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5H8A4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRLGSGTFAT CCVAIEVLGI AVFLRGFFPA PVRSSARAEH GAEPPAPEPS    50
AGASSNWTTL PPPLFSKVVI VLIDALRDDF VFGSKGVKFM PYTTYLVEKG 100
ASHSFVAEAK PPTVTMPRIK ALMTGSLPGF VDVIRNLNSP ALLEDSVIRQ 150
AKAAGKRIVF YGDETWVKLF PKHFVEYDGT TSFFVSDYTE VDNNVTRHLD 200
KVLKRGDWDI LILHYLGLDH IGHISGPNSP LIGQKLSEMD SVLMKIHTSL 250
QSKERETPLP NLLVLCGDHG MSETGSHGAS STEEVNTPLI LISSAFERKP 300
GDIRHPKHVQ QTDVAATLAI ALGLPIPKDS VGSLLFPVVE GRPMREQLRF 350
LHLNTVQLSK LLQENVPSYE KDPGFEQFKM SERLHGNWIR LYLEEKHSEV 400
LFNLGSKVLR QYLDALKTLS LSLSAQVAQY DIYSMMVGTV VVLEVLTLLL 450
LSVPQALRRK AELEVPLSSP GFSLLFYLVI LVLSAVHVIV CTSAESSCYF 500
CGLSWLAAGG VMVLASALLC VIVSVLTNVL VGGNTPRKNP MHPSSRWSEL 550
DLLILLGTAG HVLSLGASSF VEEEHQTWYF LVNTLCLALS QETYRNYFLG 600
DDGEPPCGLC VEQGHDGATA AWQDGPGCDV LERDKGHGSP STSEVLRGRE 650
KWMVLASPWL ILACCRLLRS LNQTGVQWAH RPDLGHWLTS SDHKAELSVL 700
AALSLLVVFV LVQRGCSPVS KAALALGLLG VYCYRAAIGS VRFPWRPDSK 750
DISKGIIEAR FVYVFVLGIL FTGTKDLLKS QVIAADFKLK TVGLWEIYSG 800
LVLLAALLFR PHNLPVLAFS LLIQTLMTKF IWKPLRHDAA EITVMHYWFG 850
QAFFYFQGNS NNIATVDISA GFVGLDTYVE IPAVLLTAFG TYAGPVLWAS 900
HLVHFLSSET RSGSALSHAC FCYALICSIP VFTYIVLVTS LRYHLFIWSV 950
FSPKLLYEGM HLLITAAVCV FFTAMDQTRL TQS 983
Length:983
Mass (Da):108,173
Last modified:March 1, 2005 - v1
Checksum:i18D5DF737B000D2D
GO
Isoform 2 (identifier: Q5H8A4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-444: Missing.

Note: No experimental confirmation available.

Show »
Length:975
Mass (Da):107,376
Checksum:i1D597136E243863E
GO
Isoform 3 (identifier: Q5H8A4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     120-252: Missing.

Note: No experimental confirmation available.

Show »
Length:850
Mass (Da):93,251
Checksum:i731AF8C6140D36C0
GO
Isoform 4 (identifier: Q5H8A4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     430-463: YDIYSMMVGTVVVLEVLTLLLLSVPQALRRKAEL → FSPCSCSASHRHCTERLSWKSHCHLLGFLCSFIW
     464-983: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:463
Mass (Da):51,267
Checksum:i02EDEEBFE96AC294
GO
Isoform 5 (identifier: Q5H8A4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: Missing.
     372-388: DPGFEQFKMSERLHGNW → GSHPAPAQRPTGTAQKG
     389-983: Missing.

Note: No experimental confirmation available.

Show »
Length:299
Mass (Da):32,913
Checksum:i73D96DB53EA11006
GO
Isoform 6 (identifier: Q5H8A4-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-122: Missing.
     430-463: YDIYSMMVGTVVVLEVLTLLLLSVPQALRRKAEL → FSPCSCSASHRHCAERLSWKSHCHLLGFLCSFIW
     464-983: Missing.

Note: No experimental confirmation available.

Show »
Length:341
Mass (Da):38,290
Checksum:i9DC3B4F0B1EC6633
GO

Sequence cautioni

The sequence BAA91046.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAB55130.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAQ88902.1 differs from that shown. Reason: Erroneous termination at position 311. Translated as Gln.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti55 – 551S → Y.
Corresponds to variant rs34120878 [ dbSNP | Ensembl ].
VAR_057680
Natural varianti458 – 4581R → H.1 Publication
Corresponds to variant rs13115344 [ dbSNP | Ensembl ].
VAR_027022
Natural varianti610 – 6101C → R.1 Publication
Corresponds to variant rs7666425 [ dbSNP | Ensembl ].
VAR_027023
Natural varianti699 – 6991V → I.2 Publications
Corresponds to variant rs13114026 [ dbSNP | Ensembl ].
VAR_027024
Natural varianti731 – 7311V → I.
Corresponds to variant rs34916638 [ dbSNP | Ensembl ].
VAR_060086
Natural varianti881 – 8811I → T.
Corresponds to variant rs34623004 [ dbSNP | Ensembl ].
VAR_060087
Natural varianti932 – 9321F → S.
Corresponds to variant rs1127410 [ dbSNP | Ensembl ].
VAR_027025

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 122122Missing in isoform 6. VSP_054387Add
BLAST
Alternative sequencei1 – 8989Missing in isoform 5. VSP_019827Add
BLAST
Alternative sequencei120 – 252133Missing in isoform 3. VSP_019828Add
BLAST
Alternative sequencei372 – 38817DPGFE…LHGNW → GSHPAPAQRPTGTAQKG in isoform 5. VSP_019829Add
BLAST
Alternative sequencei389 – 983595Missing in isoform 5. VSP_019830Add
BLAST
Alternative sequencei430 – 46334YDIYS…RKAEL → FSPCSCSASHRHCTERLSWK SHCHLLGFLCSFIW in isoform 4. VSP_019831Add
BLAST
Alternative sequencei430 – 46334YDIYS…RKAEL → FSPCSCSASHRHCAERLSWK SHCHLLGFLCSFIW in isoform 6. VSP_054388Add
BLAST
Alternative sequencei437 – 4448Missing in isoform 2. VSP_019832
Alternative sequencei464 – 983520Missing in isoform 4 and isoform 6. VSP_019833Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti624 – 6241D → G in BAC11227. 1 Publication
Sequence conflicti889 – 8891F → L in BAC11227. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB162713 mRNA. Translation: BAD89023.1.
AY358538 mRNA. Translation: AAQ88902.1. Sequence problems.
AK074815 mRNA. Translation: BAC11227.1.
AK000272 mRNA. Translation: BAA91046.1. Different initiation.
AK027465 mRNA. Translation: BAB55130.1. Different initiation.
AK097244 mRNA. Translation: BAC04984.1.
AK296507 mRNA. Translation: BAG59139.1.
AC092574 Genomic DNA. No translation available.
AC116565 Genomic DNA. No translation available.
BC000937 mRNA. Translation: AAH00937.2.
BC001249 mRNA. Translation: AAH01249.2.
BC110878 mRNA. Translation: AAI10879.1.
CCDSiCCDS3336.1. [Q5H8A4-2]
CCDS46992.1. [Q5H8A4-1]
RefSeqiNP_001120650.1. NM_001127178.2. [Q5H8A4-1]
NP_001275980.1. NM_001289051.1.
NP_001275981.1. NM_001289052.1. [Q5H8A4-3]
NP_001275984.1. NM_001289055.1. [Q5H8A4-6]
NP_001275986.1. NM_001289057.1. [Q5H8A4-5]
NP_060203.3. NM_017733.4. [Q5H8A4-2]
UniGeneiHs.7099.

Genome annotation databases

EnsembliENST00000296306; ENSP00000296306; ENSG00000174227. [Q5H8A4-5]
ENST00000310340; ENSP00000311750; ENSG00000174227. [Q5H8A4-2]
ENST00000383028; ENSP00000372494; ENSG00000174227. [Q5H8A4-3]
ENST00000453061; ENSP00000415203; ENSG00000174227. [Q5H8A4-1]
ENST00000503111; ENSP00000426002; ENSG00000174227. [Q5H8A4-5]
ENST00000536264; ENSP00000439240; ENSG00000174227.
ENST00000608630; ENSP00000477115; ENSG00000272607. [Q5H8A4-5]
ENST00000608848; ENSP00000476904; ENSG00000272607. [Q5H8A4-5]
ENST00000609956; ENSP00000476441; ENSG00000272607. [Q5H8A4-2]
ENST00000609968; ENSP00000476666; ENSG00000272607. [Q5H8A4-1]
ENST00000610174; ENSP00000476513; ENSG00000272607. [Q5H8A4-3]
GeneIDi54872.
KEGGihsa:54872.
UCSCiuc003gaj.4. human. [Q5H8A4-2]
uc003gak.4. human. [Q5H8A4-1]
uc003gam.3. human. [Q5H8A4-5]
uc010ibf.3. human. [Q5H8A4-3]

Polymorphism databases

DMDMi74707851.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB162713 mRNA. Translation: BAD89023.1 .
AY358538 mRNA. Translation: AAQ88902.1 . Sequence problems.
AK074815 mRNA. Translation: BAC11227.1 .
AK000272 mRNA. Translation: BAA91046.1 . Different initiation.
AK027465 mRNA. Translation: BAB55130.1 . Different initiation.
AK097244 mRNA. Translation: BAC04984.1 .
AK296507 mRNA. Translation: BAG59139.1 .
AC092574 Genomic DNA. No translation available.
AC116565 Genomic DNA. No translation available.
BC000937 mRNA. Translation: AAH00937.2 .
BC001249 mRNA. Translation: AAH01249.2 .
BC110878 mRNA. Translation: AAI10879.1 .
CCDSi CCDS3336.1. [Q5H8A4-2 ]
CCDS46992.1. [Q5H8A4-1 ]
RefSeqi NP_001120650.1. NM_001127178.2. [Q5H8A4-1 ]
NP_001275980.1. NM_001289051.1.
NP_001275981.1. NM_001289052.1. [Q5H8A4-3 ]
NP_001275984.1. NM_001289055.1. [Q5H8A4-6 ]
NP_001275986.1. NM_001289057.1. [Q5H8A4-5 ]
NP_060203.3. NM_017733.4. [Q5H8A4-2 ]
UniGenei Hs.7099.

3D structure databases

ProteinModelPortali Q5H8A4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120220. 5 interactions.
MINTi MINT-3042035.

PTM databases

PhosphoSitei Q5H8A4.

Polymorphism databases

DMDMi 74707851.

Proteomic databases

MaxQBi Q5H8A4.
PaxDbi Q5H8A4.
PRIDEi Q5H8A4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000296306 ; ENSP00000296306 ; ENSG00000174227 . [Q5H8A4-5 ]
ENST00000310340 ; ENSP00000311750 ; ENSG00000174227 . [Q5H8A4-2 ]
ENST00000383028 ; ENSP00000372494 ; ENSG00000174227 . [Q5H8A4-3 ]
ENST00000453061 ; ENSP00000415203 ; ENSG00000174227 . [Q5H8A4-1 ]
ENST00000503111 ; ENSP00000426002 ; ENSG00000174227 . [Q5H8A4-5 ]
ENST00000536264 ; ENSP00000439240 ; ENSG00000174227 .
ENST00000608630 ; ENSP00000477115 ; ENSG00000272607 . [Q5H8A4-5 ]
ENST00000608848 ; ENSP00000476904 ; ENSG00000272607 . [Q5H8A4-5 ]
ENST00000609956 ; ENSP00000476441 ; ENSG00000272607 . [Q5H8A4-2 ]
ENST00000609968 ; ENSP00000476666 ; ENSG00000272607 . [Q5H8A4-1 ]
ENST00000610174 ; ENSP00000476513 ; ENSG00000272607 . [Q5H8A4-3 ]
GeneIDi 54872.
KEGGi hsa:54872.
UCSCi uc003gaj.4. human. [Q5H8A4-2 ]
uc003gak.4. human. [Q5H8A4-1 ]
uc003gam.3. human. [Q5H8A4-5 ]
uc010ibf.3. human. [Q5H8A4-3 ]

Organism-specific databases

CTDi 54872.
GeneCardsi GC04P000486.
HGNCi HGNC:25985. PIGG.
HPAi HPA015997.
neXtProti NX_Q5H8A4.
PharmGKBi PA143485575.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1524.
HOVERGENi HBG075245.
InParanoidi Q5H8A4.
KOi K05310.
OMAi QTWYFLV.
OrthoDBi EOG7B8S35.
PhylomeDBi Q5H8A4.
TreeFami TF300609.

Enzyme and pathway databases

UniPathwayi UPA00196 .
Reactomei REACT_952. Synthesis of glycosylphosphatidylinositol (GPI).

Miscellaneous databases

GenomeRNAii 54872.
NextBioi 35472752.
PROi Q5H8A4.

Gene expression databases

ArrayExpressi Q5H8A4.
Bgeei Q5H8A4.
CleanExi HS_PIGG.
Genevestigatori Q5H8A4.

Family and domain databases

Gene3Di 3.40.720.10. 1 hit.
InterProi IPR017849. Alkaline_Pase-like_a/b/a.
IPR017850. Alkaline_phosphatase_core.
IPR002591. Phosphodiest/P_Trfase.
[Graphical view ]
Pfami PF01663. Phosphodiest. 1 hit.
[Graphical view ]
SUPFAMi SSF53649. SSF53649. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "GPI7 is the second partner of PIG-F and involved in modification of glycosylphosphatidylinositol."
    Shishioh N., Hong Y., Ohishi K., Ashida H., Maeda Y., Kinoshita T.
    J. Biol. Chem. 280:9728-9734(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH PIGF.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
  3. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 367-983 (ISOFORM 1), VARIANT ILE-699.
    Tissue: Cervix, Colon mucosa, Teratocarcinoma and Thalamus.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANTS HIS-458; ARG-610 AND ILE-699.
    Tissue: Lung and Placenta.

Entry informationi

Entry nameiPIGG_HUMAN
AccessioniPrimary (citable) accession number: Q5H8A4
Secondary accession number(s): B4DKC7
, Q2TAK5, Q6UX31, Q7L5Y4, Q8N866, Q8NCC9, Q96SY9, Q9BVT7, Q9NXG5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: March 1, 2005
Last modified: September 3, 2014
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi