Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable E3 ubiquitin-protein ligase HERC4

Gene

HERC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable E3 ubiquitin-protein ligase involved in either protein trafficking or in the distribution of cellular structures. Required for spermatozoon maturation and fertility, and for the removal of the cytoplasmic droplet of the spermatozoon. E3 ubiquitin-protein ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer it to targeted substrates.By similarity

Catalytic activityi

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei1025Glycyl thioester intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

Differentiation, Spermatogenesis, Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable E3 ubiquitin-protein ligase HERC4 (EC:2.3.2.26)
Alternative name(s):
HECT domain and RCC1-like domain-containing protein 4
HECT-type E3 ubiquitin transferase HERC4
Gene namesi
Name:HERC4
Synonyms:KIAA1593
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:24521. HERC4.

Subcellular locationi

  • Cytoplasmcytosol 1 Publication

  • Note: shows a punctate cytoplasmic distribution.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi26091.
OpenTargetsiENSG00000148634.
PharmGKBiPA134949021.

Polymorphism and mutation databases

BioMutaiHERC4.
DMDMi74707832.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002782161 – 1057Probable E3 ubiquitin-protein ligase HERC4Add BLAST1057

Proteomic databases

EPDiQ5GLZ8.
MaxQBiQ5GLZ8.
PaxDbiQ5GLZ8.
PeptideAtlasiQ5GLZ8.
PRIDEiQ5GLZ8.

PTM databases

iPTMnetiQ5GLZ8.
PhosphoSitePlusiQ5GLZ8.

Expressioni

Tissue specificityi

Expressed in brain and testis and detected in heart and placenta.1 Publication

Developmental stagei

Expressed in fetal brain.1 Publication

Gene expression databases

BgeeiENSG00000148634.
CleanExiHS_HERC4.
ExpressionAtlasiQ5GLZ8. baseline and differential.
GenevisibleiQ5GLZ8. HS.

Organism-specific databases

HPAiHPA045453.

Interactioni

Protein-protein interaction databases

BioGridi117542. 42 interactors.
IntActiQ5GLZ8. 10 interactors.
STRINGi9606.ENSP00000378624.

Structurei

3D structure databases

ProteinModelPortaliQ5GLZ8.
SMRiQ5GLZ8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati1 – 51RCC1 1Add BLAST51
Repeati52 – 101RCC1 2Add BLAST50
Repeati102 – 154RCC1 3Add BLAST53
Repeati156 – 207RCC1 4Add BLAST52
Repeati208 – 259RCC1 5Add BLAST52
Repeati261 – 311RCC1 6Add BLAST51
Repeati313 – 368RCC1 7Add BLAST56
Domaini730 – 1057HECTPROSITE-ProRule annotationAdd BLAST328

Sequence similaritiesi

Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.PROSITE-ProRule annotation
Contains 7 RCC1 repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0941. Eukaryota.
COG5021. LUCA.
COG5184. LUCA.
GeneTreeiENSGT00860000133671.
HOGENOMiHOG000208452.
HOVERGENiHBG050878.
InParanoidiQ5GLZ8.
KOiK10615.
OrthoDBiEOG091G028I.
PhylomeDBiQ5GLZ8.
TreeFamiTF315189.

Family and domain databases

CDDicd00078. HECTc. 1 hit.
Gene3Di2.130.10.30. 1 hit.
InterProiIPR000569. HECT_dom.
IPR009091. RCC1/BLIP-II.
IPR000408. Reg_chr_condens.
[Graphical view]
PfamiPF00632. HECT. 1 hit.
PF00415. RCC1. 7 hits.
[Graphical view]
PRINTSiPR00633. RCCNDNSATION.
SMARTiSM00119. HECTc. 1 hit.
[Graphical view]
SUPFAMiSSF50985. SSF50985. 1 hit.
SSF56204. SSF56204. 1 hit.
PROSITEiPS50237. HECT. 1 hit.
PS00626. RCC1_2. 3 hits.
PS50012. RCC1_3. 7 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5GLZ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLCWGNASFG QLGLGGIDEE IVLEPRKSDF FINKRVRDVG CGLRHTVFVL
60 70 80 90 100
DDGTVYTCGC NDLGQLGHEK SRKKPEQVVA LDAQNIVAVS CGEAHTLALN
110 120 130 140 150
DKGQVYAWGL DSDGQLGLVG SEECIRVPRN IKSLSDIQIV QVACGYYHSL
160 170 180 190 200
ALSKASEVFC WGQNKYGQLG LGTDCKKQTS PQLLKSLLGI PFMQVAAGGA
210 220 230 240 250
HSFVLTLSGA IFGWGRNKFG QLGLNDENDR YVPNLLKSLR SQKIVYICCG
260 270 280 290 300
EDHTAALTKE GGVFTFGAGG YGQLGHNSTS HEINPRKVFE LMGSIVTEIA
310 320 330 340 350
CGRQHTSAFV PSSGRIYSFG LGGNGQLGTG STSNRKSPFT VKGNWYPYNG
360 370 380 390 400
QCLPDIDSEE YFCVKRIFSG GDQSFSHYSS PQNCGPPDDF RCPNPTKQIW
410 420 430 440 450
TVNEALIQKW LSYPSGRFPV EIANEIDGTF SSSGCLNGSF LAVSNDDHYR
460 470 480 490 500
TGTRFSGVDM NAARLLFHKL IQPDHPQISQ QVAASLEKNL IPKLTSSLPD
510 520 530 540 550
VEALRFYLTL PECPLMSDSN NFTTIAIPFG TALVNLEKAP LKVLENWWSV
560 570 580 590 600
LEPPLFLKIV ELFKEVVVHL LKLYKIGIPP SERRIFNSFL HTALKVLEIL
610 620 630 640 650
HRVNEKMGQI IQYDKFYIHE VQELIDIRND YINWVQQQAY GMDVNHGLTE
660 670 680 690 700
LADIPVTICT YPFVFDAQAK TTLLQTDAVL QMQMAIDQAH RQNVSSLFLP
710 720 730 740 750
VIESVNPCLI LVVRRENIVG DAMEVLRKTK NIDYKKPLKV IFVGEDAVDA
760 770 780 790 800
GGVRKEFFLL IMRELLDPKY GMFRYYEDSR LIWFSDKTFE DSDLFHLIGV
810 820 830 840 850
ICGLAIYNCT IVDLHFPLAL YKKLLKKKPS LDDLKELMPD VGRSMQQLLD
860 870 880 890 900
YPEDDIEETF CLNFTITVEN FGATEVKELV LNGADTAVNK QNRQEFVDAY
910 920 930 940 950
VDYIFNKSVA SLFDAFHAGF HKVCGGKVLL LFQPNELQAM VIGNTNYDWK
960 970 980 990 1000
ELEKNTEYKG EYWAEHPTIK IFWEVFHELP LEKKKQFLLF LTGSDRIPIL
1010 1020 1030 1040 1050
GMKSLKLVIQ STGGGEEYLP VSHTCFNLLD LPKYTEKETL RSKLIQAIDH

NEGFSLI
Length:1,057
Mass (Da):118,563
Last modified:March 1, 2005 - v1
Checksum:i7F06DA755A68243A
GO
Isoform 2 (identifier: Q5GLZ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     643-650: Missing.

Show »
Length:1,049
Mass (Da):117,697
Checksum:i0B1444455A28BDEA
GO
Isoform 3 (identifier: Q5GLZ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     788-865: Missing.

Show »
Length:979
Mass (Da):109,585
Checksum:i5EA9F00BE89BE5BD
GO
Isoform 4 (identifier: Q5GLZ8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-110: QVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGL → FRSCFPGRSAMAPSRLTATSASQVQAILLPQPPE
     111-1057: Missing.

Show »
Length:110
Mass (Da):12,026
Checksum:i74455E07E7BB358B
GO
Isoform 5 (identifier: Q5GLZ8-5) [UniParc]FASTAAdd to basket
Also known as: 2

The sequence of this isoform differs from the canonical sequence as follows:
     77-117: QVVALDAQNI...WGLDSDGQLG → ILKVCQISRL...GDRINMANWV
     118-1057: Missing.

Show »
Length:117
Mass (Da):13,215
Checksum:i3B3FE6EB8C3B9947
GO
Isoform 6 (identifier: Q5GLZ8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-110: Missing.
     111-128: DSDGQLGLVGSEECIRVP → MCVDSLVRICSGLSYGRI

Note: No experimental confirmation available.
Show »
Length:947
Mass (Da):106,715
Checksum:i3088CCEB250356B9
GO

Sequence cautioni

The sequence BAB13419 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1032P → S in AAV66579 (PubMed:15676274).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0231721 – 110Missing in isoform 6. 1 PublicationAdd BLAST110
Alternative sequenceiVSP_02317377 – 117QVVAL…DGQLG → ILKVCQISRLYRLLVVTIIH LHFLKQVKSSVGDRINMANW V in isoform 5. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_02317477 – 110QVVAL…YAWGL → FRSCFPGRSAMAPSRLTATS ASQVQAILLPQPPE in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_023175111 – 1057Missing in isoform 4. 1 PublicationAdd BLAST947
Alternative sequenceiVSP_039551111 – 128DSDGQ…CIRVP → MCVDSLVRICSGLSYGRI in isoform 6. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_023176118 – 1057Missing in isoform 5. 2 PublicationsAdd BLAST940
Alternative sequenceiVSP_023178643 – 650Missing in isoform 2. 1 Publication8
Alternative sequenceiVSP_023179788 – 865Missing in isoform 3. 1 PublicationAdd BLAST78

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY221963 mRNA. Translation: AAO65480.1.
AY650032 mRNA. Translation: AAV66578.1.
AY650033 mRNA. Translation: AAV66579.1.
AY650034 mRNA. Translation: AAV66580.1.
AB046813 mRNA. Translation: BAB13419.1. Different initiation.
AL356741, AC024258, AL133551 Genomic DNA. Translation: CAH74148.1.
AL133551, AC024258, AL356741 Genomic DNA. Translation: CAI16032.1.
BC039600 mRNA. Translation: AAH39600.1.
CCDSiCCDS41533.1. [Q5GLZ8-1]
CCDS60541.1. [Q5GLZ8-3]
CCDS60542.1. [Q5GLZ8-4]
CCDS7274.1. [Q5GLZ8-2]
RefSeqiNP_001265114.1. NM_001278185.1. [Q5GLZ8-3]
NP_001265115.1. NM_001278186.1.
NP_001265116.1. NM_001278187.1. [Q5GLZ8-4]
NP_056416.2. NM_015601.3. [Q5GLZ8-2]
NP_071362.1. NM_022079.2. [Q5GLZ8-1]
UniGeneiHs.51891.

Genome annotation databases

EnsembliENST00000277817; ENSP00000277817; ENSG00000148634. [Q5GLZ8-6]
ENST00000373700; ENSP00000362804; ENSG00000148634. [Q5GLZ8-2]
ENST00000395198; ENSP00000378624; ENSG00000148634. [Q5GLZ8-1]
ENST00000412272; ENSP00000416504; ENSG00000148634. [Q5GLZ8-3]
ENST00000473533; ENSP00000423671; ENSG00000148634. [Q5GLZ8-5]
ENST00000492996; ENSP00000422383; ENSG00000148634. [Q5GLZ8-4]
GeneIDi26091.
KEGGihsa:26091.
UCSCiuc001jng.5. human. [Q5GLZ8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY221963 mRNA. Translation: AAO65480.1.
AY650032 mRNA. Translation: AAV66578.1.
AY650033 mRNA. Translation: AAV66579.1.
AY650034 mRNA. Translation: AAV66580.1.
AB046813 mRNA. Translation: BAB13419.1. Different initiation.
AL356741, AC024258, AL133551 Genomic DNA. Translation: CAH74148.1.
AL133551, AC024258, AL356741 Genomic DNA. Translation: CAI16032.1.
BC039600 mRNA. Translation: AAH39600.1.
CCDSiCCDS41533.1. [Q5GLZ8-1]
CCDS60541.1. [Q5GLZ8-3]
CCDS60542.1. [Q5GLZ8-4]
CCDS7274.1. [Q5GLZ8-2]
RefSeqiNP_001265114.1. NM_001278185.1. [Q5GLZ8-3]
NP_001265115.1. NM_001278186.1.
NP_001265116.1. NM_001278187.1. [Q5GLZ8-4]
NP_056416.2. NM_015601.3. [Q5GLZ8-2]
NP_071362.1. NM_022079.2. [Q5GLZ8-1]
UniGeneiHs.51891.

3D structure databases

ProteinModelPortaliQ5GLZ8.
SMRiQ5GLZ8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117542. 42 interactors.
IntActiQ5GLZ8. 10 interactors.
STRINGi9606.ENSP00000378624.

PTM databases

iPTMnetiQ5GLZ8.
PhosphoSitePlusiQ5GLZ8.

Polymorphism and mutation databases

BioMutaiHERC4.
DMDMi74707832.

Proteomic databases

EPDiQ5GLZ8.
MaxQBiQ5GLZ8.
PaxDbiQ5GLZ8.
PeptideAtlasiQ5GLZ8.
PRIDEiQ5GLZ8.

Protocols and materials databases

DNASUi26091.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000277817; ENSP00000277817; ENSG00000148634. [Q5GLZ8-6]
ENST00000373700; ENSP00000362804; ENSG00000148634. [Q5GLZ8-2]
ENST00000395198; ENSP00000378624; ENSG00000148634. [Q5GLZ8-1]
ENST00000412272; ENSP00000416504; ENSG00000148634. [Q5GLZ8-3]
ENST00000473533; ENSP00000423671; ENSG00000148634. [Q5GLZ8-5]
ENST00000492996; ENSP00000422383; ENSG00000148634. [Q5GLZ8-4]
GeneIDi26091.
KEGGihsa:26091.
UCSCiuc001jng.5. human. [Q5GLZ8-1]

Organism-specific databases

CTDi26091.
DisGeNETi26091.
GeneCardsiHERC4.
HGNCiHGNC:24521. HERC4.
HPAiHPA045453.
MIMi609248. gene.
neXtProtiNX_Q5GLZ8.
OpenTargetsiENSG00000148634.
PharmGKBiPA134949021.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0941. Eukaryota.
COG5021. LUCA.
COG5184. LUCA.
GeneTreeiENSGT00860000133671.
HOGENOMiHOG000208452.
HOVERGENiHBG050878.
InParanoidiQ5GLZ8.
KOiK10615.
OrthoDBiEOG091G028I.
PhylomeDBiQ5GLZ8.
TreeFamiTF315189.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.

Miscellaneous databases

ChiTaRSiHERC4. human.
GenomeRNAii26091.
PROiQ5GLZ8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000148634.
CleanExiHS_HERC4.
ExpressionAtlasiQ5GLZ8. baseline and differential.
GenevisibleiQ5GLZ8. HS.

Family and domain databases

CDDicd00078. HECTc. 1 hit.
Gene3Di2.130.10.30. 1 hit.
InterProiIPR000569. HECT_dom.
IPR009091. RCC1/BLIP-II.
IPR000408. Reg_chr_condens.
[Graphical view]
PfamiPF00632. HECT. 1 hit.
PF00415. RCC1. 7 hits.
[Graphical view]
PRINTSiPR00633. RCCNDNSATION.
SMARTiSM00119. HECTc. 1 hit.
[Graphical view]
SUPFAMiSSF50985. SSF50985. 1 hit.
SSF56204. SSF56204. 1 hit.
PROSITEiPS50237. HECT. 1 hit.
PS00626. RCC1_2. 3 hits.
PS50012. RCC1_3. 7 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiHERC4_HUMAN
AccessioniPrimary (citable) accession number: Q5GLZ8
Secondary accession number(s): Q5GC98
, Q5GC99, Q5GCA0, Q8IXP9, Q9HCH9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: March 1, 2005
Last modified: November 30, 2016
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.