Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable E3 ubiquitin-protein ligase HERC4

Gene

HERC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable E3 ubiquitin-protein ligase involved in either protein trafficking or in the distribution of cellular structures. Required for spermatozoon maturation and fertility, and for the removal of the cytoplasmic droplet of the spermatozoon. E3 ubiquitin-protein ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer it to targeted substrates.By similarity

Catalytic activityi

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N6-ubiquitinyl-[acceptor protein]-L-lysine.

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei1025Glycyl thioester intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

  • cell differentiation Source: UniProtKB-KW
  • spermatogenesis Source: UniProtKB

Keywordsi

Molecular functionTransferase
Biological processDifferentiation, Spermatogenesis, Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
UniPathwayiUPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Probable E3 ubiquitin-protein ligase HERC4 (EC:2.3.2.26)
Alternative name(s):
HECT domain and RCC1-like domain-containing protein 4
HECT-type E3 ubiquitin transferase HERC4
Gene namesi
Name:HERC4
Synonyms:KIAA1593
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000148634.15
HGNCiHGNC:24521 HERC4
MIMi609248 gene
neXtProtiNX_Q5GLZ8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi26091
OpenTargetsiENSG00000148634
PharmGKBiPA134949021

Polymorphism and mutation databases

BioMutaiHERC4
DMDMi74707832

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002782161 – 1057Probable E3 ubiquitin-protein ligase HERC4Add BLAST1057

Proteomic databases

EPDiQ5GLZ8
MaxQBiQ5GLZ8
PaxDbiQ5GLZ8
PeptideAtlasiQ5GLZ8
PRIDEiQ5GLZ8

PTM databases

iPTMnetiQ5GLZ8
PhosphoSitePlusiQ5GLZ8

Expressioni

Tissue specificityi

Expressed in brain and testis and detected in heart and placenta.1 Publication

Developmental stagei

Expressed in fetal brain.1 Publication

Gene expression databases

BgeeiENSG00000148634
CleanExiHS_HERC4
ExpressionAtlasiQ5GLZ8 baseline and differential
GenevisibleiQ5GLZ8 HS

Organism-specific databases

HPAiHPA045453
HPA070301

Interactioni

Protein-protein interaction databases

BioGridi117542, 44 interactors
IntActiQ5GLZ8, 10 interactors
STRINGi9606.ENSP00000378624

Structurei

3D structure databases

ProteinModelPortaliQ5GLZ8
SMRiQ5GLZ8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati1 – 51RCC1 1Add BLAST51
Repeati52 – 101RCC1 2Add BLAST50
Repeati102 – 154RCC1 3Add BLAST53
Repeati156 – 207RCC1 4Add BLAST52
Repeati208 – 259RCC1 5Add BLAST52
Repeati261 – 311RCC1 6Add BLAST51
Repeati313 – 368RCC1 7Add BLAST56
Domaini730 – 1057HECTPROSITE-ProRule annotationAdd BLAST328

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0941 Eukaryota
COG5021 LUCA
COG5184 LUCA
GeneTreeiENSGT00910000144004
HOGENOMiHOG000208452
HOVERGENiHBG050878
InParanoidiQ5GLZ8
KOiK10615
OrthoDBiEOG091G028I
PhylomeDBiQ5GLZ8
TreeFamiTF315189

Family and domain databases

CDDicd00078 HECTc, 1 hit
Gene3Di2.130.10.30, 2 hits
InterProiView protein in InterPro
IPR000569 HECT_dom
IPR035983 Hect_E3_ubiquitin_ligase
IPR009091 RCC1/BLIP-II
IPR000408 Reg_chr_condens
PfamiView protein in Pfam
PF00632 HECT, 1 hit
PF00415 RCC1, 7 hits
PRINTSiPR00633 RCCNDNSATION
SMARTiView protein in SMART
SM00119 HECTc, 1 hit
SUPFAMiSSF50985 SSF50985, 1 hit
SSF56204 SSF56204, 1 hit
PROSITEiView protein in PROSITE
PS50237 HECT, 1 hit
PS00626 RCC1_2, 3 hits
PS50012 RCC1_3, 7 hits

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5GLZ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLCWGNASFG QLGLGGIDEE IVLEPRKSDF FINKRVRDVG CGLRHTVFVL
60 70 80 90 100
DDGTVYTCGC NDLGQLGHEK SRKKPEQVVA LDAQNIVAVS CGEAHTLALN
110 120 130 140 150
DKGQVYAWGL DSDGQLGLVG SEECIRVPRN IKSLSDIQIV QVACGYYHSL
160 170 180 190 200
ALSKASEVFC WGQNKYGQLG LGTDCKKQTS PQLLKSLLGI PFMQVAAGGA
210 220 230 240 250
HSFVLTLSGA IFGWGRNKFG QLGLNDENDR YVPNLLKSLR SQKIVYICCG
260 270 280 290 300
EDHTAALTKE GGVFTFGAGG YGQLGHNSTS HEINPRKVFE LMGSIVTEIA
310 320 330 340 350
CGRQHTSAFV PSSGRIYSFG LGGNGQLGTG STSNRKSPFT VKGNWYPYNG
360 370 380 390 400
QCLPDIDSEE YFCVKRIFSG GDQSFSHYSS PQNCGPPDDF RCPNPTKQIW
410 420 430 440 450
TVNEALIQKW LSYPSGRFPV EIANEIDGTF SSSGCLNGSF LAVSNDDHYR
460 470 480 490 500
TGTRFSGVDM NAARLLFHKL IQPDHPQISQ QVAASLEKNL IPKLTSSLPD
510 520 530 540 550
VEALRFYLTL PECPLMSDSN NFTTIAIPFG TALVNLEKAP LKVLENWWSV
560 570 580 590 600
LEPPLFLKIV ELFKEVVVHL LKLYKIGIPP SERRIFNSFL HTALKVLEIL
610 620 630 640 650
HRVNEKMGQI IQYDKFYIHE VQELIDIRND YINWVQQQAY GMDVNHGLTE
660 670 680 690 700
LADIPVTICT YPFVFDAQAK TTLLQTDAVL QMQMAIDQAH RQNVSSLFLP
710 720 730 740 750
VIESVNPCLI LVVRRENIVG DAMEVLRKTK NIDYKKPLKV IFVGEDAVDA
760 770 780 790 800
GGVRKEFFLL IMRELLDPKY GMFRYYEDSR LIWFSDKTFE DSDLFHLIGV
810 820 830 840 850
ICGLAIYNCT IVDLHFPLAL YKKLLKKKPS LDDLKELMPD VGRSMQQLLD
860 870 880 890 900
YPEDDIEETF CLNFTITVEN FGATEVKELV LNGADTAVNK QNRQEFVDAY
910 920 930 940 950
VDYIFNKSVA SLFDAFHAGF HKVCGGKVLL LFQPNELQAM VIGNTNYDWK
960 970 980 990 1000
ELEKNTEYKG EYWAEHPTIK IFWEVFHELP LEKKKQFLLF LTGSDRIPIL
1010 1020 1030 1040 1050
GMKSLKLVIQ STGGGEEYLP VSHTCFNLLD LPKYTEKETL RSKLIQAIDH

NEGFSLI
Length:1,057
Mass (Da):118,563
Last modified:March 1, 2005 - v1
Checksum:i7F06DA755A68243A
GO
Isoform 2 (identifier: Q5GLZ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     643-650: Missing.

Show »
Length:1,049
Mass (Da):117,697
Checksum:i0B1444455A28BDEA
GO
Isoform 3 (identifier: Q5GLZ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     788-865: Missing.

Show »
Length:979
Mass (Da):109,585
Checksum:i5EA9F00BE89BE5BD
GO
Isoform 4 (identifier: Q5GLZ8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-110: QVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGL → FRSCFPGRSAMAPSRLTATSASQVQAILLPQPPE
     111-1057: Missing.

Show »
Length:110
Mass (Da):12,026
Checksum:i74455E07E7BB358B
GO
Isoform 5 (identifier: Q5GLZ8-5) [UniParc]FASTAAdd to basket
Also known as: 2

The sequence of this isoform differs from the canonical sequence as follows:
     77-117: QVVALDAQNI...WGLDSDGQLG → ILKVCQISRL...GDRINMANWV
     118-1057: Missing.

Show »
Length:117
Mass (Da):13,215
Checksum:i3B3FE6EB8C3B9947
GO
Isoform 6 (identifier: Q5GLZ8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-110: Missing.
     111-128: DSDGQLGLVGSEECIRVP → MCVDSLVRICSGLSYGRI

Note: No experimental confirmation available.
Show »
Length:947
Mass (Da):106,715
Checksum:i3088CCEB250356B9
GO

Sequence cautioni

The sequence BAB13419 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1032P → S in AAV66579 (PubMed:15676274).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0231721 – 110Missing in isoform 6. 1 PublicationAdd BLAST110
Alternative sequenceiVSP_02317377 – 117QVVAL…DGQLG → ILKVCQISRLYRLLVVTIIH LHFLKQVKSSVGDRINMANW V in isoform 5. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_02317477 – 110QVVAL…YAWGL → FRSCFPGRSAMAPSRLTATS ASQVQAILLPQPPE in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_023175111 – 1057Missing in isoform 4. 1 PublicationAdd BLAST947
Alternative sequenceiVSP_039551111 – 128DSDGQ…CIRVP → MCVDSLVRICSGLSYGRI in isoform 6. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_023176118 – 1057Missing in isoform 5. 2 PublicationsAdd BLAST940
Alternative sequenceiVSP_023178643 – 650Missing in isoform 2. 1 Publication8
Alternative sequenceiVSP_023179788 – 865Missing in isoform 3. 1 PublicationAdd BLAST78

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY221963 mRNA Translation: AAO65480.1
AY650032 mRNA Translation: AAV66578.1
AY650033 mRNA Translation: AAV66579.1
AY650034 mRNA Translation: AAV66580.1
AB046813 mRNA Translation: BAB13419.1 Different initiation.
AL356741, AC024258, AL133551 Genomic DNA Translation: CAH74148.1
AL133551, AC024258, AL356741 Genomic DNA Translation: CAI16032.1
BC039600 mRNA Translation: AAH39600.1
CCDSiCCDS41533.1 [Q5GLZ8-1]
CCDS60541.1 [Q5GLZ8-3]
CCDS60542.1 [Q5GLZ8-4]
CCDS7274.1 [Q5GLZ8-2]
RefSeqiNP_001265114.1, NM_001278185.1 [Q5GLZ8-3]
NP_001265115.1, NM_001278186.1
NP_001265116.1, NM_001278187.1 [Q5GLZ8-4]
NP_056416.2, NM_015601.3 [Q5GLZ8-2]
NP_071362.1, NM_022079.2 [Q5GLZ8-1]
UniGeneiHs.51891

Genome annotation databases

EnsembliENST00000277817; ENSP00000277817; ENSG00000148634 [Q5GLZ8-6]
ENST00000373700; ENSP00000362804; ENSG00000148634 [Q5GLZ8-2]
ENST00000395198; ENSP00000378624; ENSG00000148634 [Q5GLZ8-1]
ENST00000412272; ENSP00000416504; ENSG00000148634 [Q5GLZ8-3]
ENST00000473533; ENSP00000423671; ENSG00000148634 [Q5GLZ8-5]
ENST00000492996; ENSP00000422383; ENSG00000148634 [Q5GLZ8-4]
GeneIDi26091
KEGGihsa:26091
UCSCiuc001jng.5 human [Q5GLZ8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiHERC4_HUMAN
AccessioniPrimary (citable) accession number: Q5GLZ8
Secondary accession number(s): Q5GC98
, Q5GC99, Q5GCA0, Q8IXP9, Q9HCH9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: March 1, 2005
Last modified: March 28, 2018
This is version 119 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health