Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

von Willebrand factor A domain-containing protein 2

Gene

VWA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei267 – 2682Cleavage

GO - Molecular functioni

  1. identical protein binding Source: UniProtKB

GO - Biological processi

  1. calcium-independent cell-matrix adhesion Source: Ensembl
  2. protein homooligomerization Source: UniProtKB
  3. regulation of insulin receptor signaling pathway Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
von Willebrand factor A domain-containing protein 2
Alternative name(s):
A domain-containing protein similar to matrilin and collagen
Short name:
AMACO
Colon cancer secreted protein 2
Short name:
CCSP-2
Gene namesi
Name:VWA2
Synonyms:AMACO
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:24709. VWA2.

Subcellular locationi

GO - Cellular componenti

  1. basement membrane Source: Ensembl
  2. extracellular space Source: UniProtKB
  3. extracellular vesicular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670613.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323Sequence AnalysisAdd
BLAST
Chaini24 – 755732von Willebrand factor A domain-containing protein 2PRO_0000307362Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi147 – 1471N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi299 ↔ 310PROSITE-ProRule annotation
Disulfide bondi304 ↔ 320PROSITE-ProRule annotation
Disulfide bondi322 ↔ 332PROSITE-ProRule annotation
Disulfide bondi716 ↔ 727PROSITE-ProRule annotation
Disulfide bondi721 ↔ 736PROSITE-ProRule annotation
Disulfide bondi738 ↔ 747PROSITE-ProRule annotation

Post-translational modificationi

A 55 kDa form is produced by proteolytic cleavage.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ5GFL6.
PRIDEiQ5GFL6.

PTM databases

PhosphoSiteiQ5GFL6.

Expressioni

Tissue specificityi

Expression is generally absent in normal colon and other normal body tissues, but it is induced an average of 78-fold in Stage II, III, and IV colon cancers, as well as in colon adenomas and colon cancer cell lines.1 Publication

Gene expression databases

BgeeiQ5GFL6.
CleanExiHS_VWA2.
GenevestigatoriQ5GFL6.

Organism-specific databases

HPAiHPA037847.

Interactioni

Subunit structurei

Forms monomers and multimers.By similarity

Protein-protein interaction databases

BioGridi131091. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ5GFL6.
SMRiQ5GFL6. Positions 51-200, 339-710.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini51 – 222172VWFA 1PROSITE-ProRule annotationAdd
BLAST
Domaini296 – 33338EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini343 – 517175VWFA 2PROSITE-ProRule annotationAdd
BLAST
Domaini531 – 705175VWFA 3PROSITE-ProRule annotationAdd
BLAST
Domaini712 – 74837EGF-like 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 EGF-like domains.PROSITE-ProRule annotation
Contains 3 VWFA domains.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG257441.
GeneTreeiENSGT00760000119000.
HOVERGENiHBG055835.
InParanoidiQ5GFL6.
OMAiFPRWEEL.
OrthoDBiEOG71P290.
PhylomeDBiQ5GFL6.
TreeFamiTF318242.

Family and domain databases

Gene3Di3.40.50.410. 3 hits.
InterProiIPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR002035. VWF_A.
[Graphical view]
PfamiPF00008. EGF. 2 hits.
PF00092. VWA. 3 hits.
[Graphical view]
SMARTiSM00181. EGF. 2 hits.
SM00327. VWA. 3 hits.
[Graphical view]
SUPFAMiSSF53300. SSF53300. 3 hits.
PROSITEiPS00022. EGF_1. 1 hit.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 2 hits.
PS50234. VWFA. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5GFL6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPPFLLLEAV CVFLFSRVPP SLPLQEVHVS KETIGKISAA SKMMWCSAAV
60 70 80 90 100
DIMFLLDGSN SVGKGSFERS KHFAITVCDG LDISPERVRV GAFQFSSTPH
110 120 130 140 150
LEFPLDSFST QQEVKARIKR MVFKGGRTET ELALKYLLHR GLPGGRNASV
160 170 180 190 200
PQILIIVTDG KSQGDVALPS KQLKERGVTV FAVGVRFPRW EELHALASEP
210 220 230 240 250
RGQHVLLAEQ VEDATNGLFS TLSSSAICSS ATPDCRVEAH PCEHRTLEMV
260 270 280 290 300
REFAGNAPCW RGSRRTLAVL AAHCPFYSWK RVFLTHPATC YRTTCPGPCD
310 320 330 340 350
SQPCQNGGTC VPEGLDGYQC LCPLAFGGEA NCALKLSLEC RVDLLFLLDS
360 370 380 390 400
SAGTTLDGFL RAKVFVKRFV RAVLSEDSRA RVGVATYSRE LLVAVPVGEY
410 420 430 440 450
QDVPDLVWSL DGIPFRGGPT LTGSALRQAA ERGFGSATRT GQDRPRRVVV
460 470 480 490 500
LLTESHSEDE VAGPARHARA RELLLLGVGS EAVRAELEEI TGSPKHVMVY
510 520 530 540 550
SDPQDLFNQI PELQGKLCSR QRPGCRTQAL DLVFMLDTSA SVGPENFAQM
560 570 580 590 600
QSFVRSCALQ FEVNPDVTQV GLVVYGSQVQ TAFGLDTKPT RAAMLRAISQ
610 620 630 640 650
APYLGGVGSA GTALLHIYDK VMTVQRGARP GVPKAVVVLT GGRGAEDAAV
660 670 680 690 700
PAQKLRNNGI SVLVVGVGPV LSEGLRRLAG PRDSLIHVAA YADLRYHQDV
710 720 730 740 750
LIEWLCGEAK QPVNLCKPSP CMNEGSCVLQ NGSYRCKCRD GWEGPHCENR

FLRRP
Length:755
Mass (Da):82,012
Last modified:March 1, 2005 - v1
Checksum:iE02B99335BE28BEC
GO
Isoform 2 (identifier: Q5GFL6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     708-755: EAKQPVNLCKPSPCMNEGSCVLQNGSYRCKCRDGWEGPHCENRFLRRP → GEWGNPHPQGCPHGRPSA

Show »
Length:725
Mass (Da):78,401
Checksum:iA0B88F49470BCA27
GO
Isoform 3 (identifier: Q5GFL6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-304: Missing.
     305-332: QNGGTCVPEGLDGYQCLCPLAFGGEANC → MEAHVFQKDWTATSASARWPLEGRLTVV
     708-755: EAKQPVNLCKPSPCMNEGSCVLQNGSYRCKCRDGWEGPHCENRFLRRP → GEWGNPHPQGCPHGRPSA

Note: No experimental confirmation available.

Show »
Length:421
Mass (Da):45,345
Checksum:iC0C7932BF705B1FB
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti76 – 761T → A in BAC87116. (PubMed:14702039)Curated
Sequence conflicti428 – 4281Q → R in CAD60276. (PubMed:14506275)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti9 – 91A → T.2 Publications
Corresponds to variant rs9664945 [ dbSNP | Ensembl ].
VAR_035418
Natural varianti131 – 1311E → G.1 Publication
Corresponds to variant rs597371 [ dbSNP | Ensembl ].
VAR_035419
Natural varianti137 – 1371L → R in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_036641

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 304304Missing in isoform 3. 1 PublicationVSP_028737Add
BLAST
Alternative sequencei305 – 33228QNGGT…GEANC → MEAHVFQKDWTATSASARWP LEGRLTVV in isoform 3. 1 PublicationVSP_028738Add
BLAST
Alternative sequencei708 – 75548EAKQP…FLRRP → GEWGNPHPQGCPHGRPSA in isoform 2 and isoform 3. 2 PublicationsVSP_028739Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ616914 mRNA. Translation: CAE83814.1.
AJ536328 mRNA. Translation: CAD60276.1.
AY572972 mRNA. Translation: AAT77225.1.
AY572973 Genomic DNA. Translation: AAT77226.1.
AK122716 mRNA. Translation: BAC85505.1.
AK127756 mRNA. Translation: BAC87116.1.
AC005383 Genomic DNA. No translation available.
AC022023 Genomic DNA. No translation available.
BC128588 mRNA. Translation: AAI28589.1.
CCDSiCCDS7589.2. [Q5GFL6-1]
RefSeqiNP_001258975.1. NM_001272046.1. [Q5GFL6-1]
UniGeneiHs.197741.

Genome annotation databases

EnsembliENST00000392982; ENSP00000376708; ENSG00000165816. [Q5GFL6-1]
ENST00000603594; ENSP00000473752; ENSG00000165816. [Q5GFL6-3]
GeneIDi340706.
KEGGihsa:340706.
UCSCiuc001lbk.2. human. [Q5GFL6-2]
uc001lbl.2. human. [Q5GFL6-1]
uc009xyf.2. human. [Q5GFL6-3]

Polymorphism databases

DMDMi74722595.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ616914 mRNA. Translation: CAE83814.1.
AJ536328 mRNA. Translation: CAD60276.1.
AY572972 mRNA. Translation: AAT77225.1.
AY572973 Genomic DNA. Translation: AAT77226.1.
AK122716 mRNA. Translation: BAC85505.1.
AK127756 mRNA. Translation: BAC87116.1.
AC005383 Genomic DNA. No translation available.
AC022023 Genomic DNA. No translation available.
BC128588 mRNA. Translation: AAI28589.1.
CCDSiCCDS7589.2. [Q5GFL6-1]
RefSeqiNP_001258975.1. NM_001272046.1. [Q5GFL6-1]
UniGeneiHs.197741.

3D structure databases

ProteinModelPortaliQ5GFL6.
SMRiQ5GFL6. Positions 51-200, 339-710.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131091. 1 interaction.

PTM databases

PhosphoSiteiQ5GFL6.

Polymorphism databases

DMDMi74722595.

Proteomic databases

PaxDbiQ5GFL6.
PRIDEiQ5GFL6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000392982; ENSP00000376708; ENSG00000165816. [Q5GFL6-1]
ENST00000603594; ENSP00000473752; ENSG00000165816. [Q5GFL6-3]
GeneIDi340706.
KEGGihsa:340706.
UCSCiuc001lbk.2. human. [Q5GFL6-2]
uc001lbl.2. human. [Q5GFL6-1]
uc009xyf.2. human. [Q5GFL6-3]

Organism-specific databases

CTDi340706.
GeneCardsiGC10P115990.
HGNCiHGNC:24709. VWA2.
HPAiHPA037847.
neXtProtiNX_Q5GFL6.
PharmGKBiPA142670613.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG257441.
GeneTreeiENSGT00760000119000.
HOVERGENiHBG055835.
InParanoidiQ5GFL6.
OMAiFPRWEEL.
OrthoDBiEOG71P290.
PhylomeDBiQ5GFL6.
TreeFamiTF318242.

Miscellaneous databases

GeneWikiiVWA2.
GenomeRNAii340706.
NextBioi98002.
PROiQ5GFL6.

Gene expression databases

BgeeiQ5GFL6.
CleanExiHS_VWA2.
GenevestigatoriQ5GFL6.

Family and domain databases

Gene3Di3.40.50.410. 3 hits.
InterProiIPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR002035. VWF_A.
[Graphical view]
PfamiPF00008. EGF. 2 hits.
PF00092. VWA. 3 hits.
[Graphical view]
SMARTiSM00181. EGF. 2 hits.
SM00327. VWA. 3 hits.
[Graphical view]
SUPFAMiSSF53300. SSF53300. 3 hits.
PROSITEiPS00022. EGF_1. 1 hit.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 2 hits.
PS50234. VWFA. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of AMACO, a new member of the von Willebrand factor A-like domain protein superfamily with a regulated expression in the kidney."
    Sengle G., Kobbe B., Moergelin M., Paulsson M., Wagener R.
    J. Biol. Chem. 278:50240-50249(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-9.
    Tissue: Placenta.
  2. "Colon cancer secreted protein-2 (CCSP-2), a novel candidate serological marker of colon neoplasia."
    Xin B., Platzer P., Fink S.P., Reese L., Nosrati A., Willson J.K.V., Wilson K., Markowitz S.
    Oncogene 24:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), TISSUE SPECIFICITY, PROTEOLYTIC PROCESSING, IDENTIFICATION BY MASS SPECTROMETRY.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS THR-9 AND GLY-131.
    Tissue: Brain and Tongue.
  4. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  6. Cited for: VARIANT [LARGE SCALE ANALYSIS] ARG-137.

Entry informationi

Entry nameiVWA2_HUMAN
AccessioniPrimary (citable) accession number: Q5GFL6
Secondary accession number(s): A1A5D4
, B5MDJ8, Q6ZS39, Q6ZWJ7, Q708C5, Q70UZ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: March 1, 2005
Last modified: February 4, 2015
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

May be used as a serological marker for colon neoplasia.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.