Q5GFL6 (VWA2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 76.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: von Willebrand factor A domain-containing protein 2 Alternative name(s): A domain-containing protein similar to matrilin and collagen Short name=AMACO Colon cancer secreted protein 2 Short name=CCSP-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 755 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Forms monomers and multimers By similarity. |
| Subcellular location | |
| Tissue specificity | Expression is generally absent in normal colon and other normal body tissues, but it is induced an average of 78-fold in Stage II, III, and IV colon cancers, as well as in colon adenomas and colon cancer cell lines. Ref.2 |
| Post-translational modification | A 55 kDa form is produced by proteolytic cleavage. |
| Miscellaneous | May be used as a serological marker for colon neoplasia. |
| Sequence similarities | Contains 2 EGF-like domains. Contains 3 VWFA domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | EGF-like domain Repeat Signal |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | calcium-independent cell-matrix adhesion Inferred from electronic annotation. Source: Compara |
| Cellular_component | basement membrane Inferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5GFL6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5GFL6-2) The sequence of this isoform differs from the canonical sequence as follows: 708-755: EAKQPVNLCKPSPCMNEGSCVLQNGSYRCKCRDGWEGPHCENRFLRRP → GEWGNPHPQGCPHGRPSA | ||||||
| Isoform 3 (identifier: Q5GFL6-3) The sequence of this isoform differs from the canonical sequence as follows: 1-304: Missing. 305-332: QNGGTCVPEGLDGYQCLCPLAFGGEANC → MEAHVFQKDWTATSASARWPLEGRLTVV 708-755: EAKQPVNLCKPSPCMNEGSCVLQNGSYRCKCRDGWEGPHCENRFLRRP → GEWGNPHPQGCPHGRPSA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | ||||||||
| Chain | 24 – 755 | 732 | von Willebrand factor A domain-containing protein 2 | PRO_0000307362 | |||||||
Regions | |||||||||||
| Domain | 51 – 222 | 172 | VWFA 1 | ||||||||
| Domain | 296 – 333 | 38 | EGF-like 1 | ||||||||
| Domain | 343 – 517 | 175 | VWFA 2 | ||||||||
| Domain | 531 – 705 | 175 | VWFA 3 | ||||||||
| Domain | 712 – 748 | 37 | EGF-like 2 | ||||||||
Sites | |||||||||||
| Site | 267 – 268 | 2 | Cleavage | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 147 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 299 ↔ 310 | By similarity | |||||||||
| Disulfide bond | 304 ↔ 320 | By similarity | |||||||||
| Disulfide bond | 322 ↔ 332 | By similarity | |||||||||
| Disulfide bond | 716 ↔ 727 | By similarity | |||||||||
| Disulfide bond | 721 ↔ 736 | By similarity | |||||||||
| Disulfide bond | 738 ↔ 747 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 304 | 304 | Missing in isoform 3. | VSP_028737 | |||||||
| Alternative sequence | 305 – 332 | 28 | QNGGT…GEANC → MEAHVFQKDWTATSASARWP LEGRLTVV in isoform 3. | VSP_028738 | |||||||
| Alternative sequence | 708 – 755 | 48 | EAKQP…FLRRP → GEWGNPHPQGCPHGRPSA in isoform 2 and isoform 3. | VSP_028739 | |||||||
| Natural variant | 9 | 1 | A → T. Ref.1 Ref.3 Corresponds to variant rs9664945 [ dbSNP | Ensembl ]. | VAR_035418 | |||||||
| Natural variant | 131 | 1 | E → G. Ref.3 Corresponds to variant rs597371 [ dbSNP | Ensembl ]. | VAR_035419 | |||||||
| Natural variant | 137 | 1 | L → R in a colorectal cancer sample; somatic mutation. Ref.6 | VAR_036641 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 76 | 1 | T → A in BAC87116. Ref.3 | ||||||||
| Sequence conflict | 428 | 1 | Q → R in CAD60276. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of AMACO, a new member of the von Willebrand factor A-like domain protein superfamily with a regulated expression in the kidney." Sengle G., Kobbe B., Moergelin M., Paulsson M., Wagener R. J. Biol. Chem. 278:50240-50249(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-9. Tissue: Placenta. |
| [2] | "Colon cancer secreted protein-2 (CCSP-2), a novel candidate serological marker of colon neoplasia." Xin B., Platzer P., Fink S.P., Reese L., Nosrati A., Willson J.K.V., Wilson K., Markowitz S. Oncogene 24:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), TISSUE SPECIFICITY, PROTEOLYTIC PROCESSING, MASS SPECTROMETRY. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS THR-9 AND GLY-131. Tissue: Brain and Tongue. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [6] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] ARG-137. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ616914 mRNA. Translation: CAE83814.1. AJ536328 mRNA. Translation: CAD60276.1. AY572972 mRNA. Translation: AAT77225.1. AY572973 Genomic DNA. Translation: AAT77226.1. AK122716 mRNA. Translation: BAC85505.1. AK127756 mRNA. Translation: BAC87116.1. AC005383 Genomic DNA. No translation available. AC022023 Genomic DNA. No translation available. BC128588 mRNA. Translation: AAI28589.1. |
| IPI | IPI00394834. IPI00645921. IPI00827672. |
| RefSeq | NP_001258975.1. NM_001272046.1. |
| UniGene | Hs.735561. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1TOZ based on UniProtKB P46531. |
| ProteinModelPortal | Q5GFL6. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q5GFL6. |
Polymorphism databases | |
| DMDM | 74722595. |
Proteomic databases | |
| PaxDb | Q5GFL6. |
| PRIDE | Q5GFL6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000298715; ENSP00000298715; ENSG00000165816. ENST00000392982; ENSP00000376708; ENSG00000165816. |
| GeneID | 340706. |
| KEGG | hsa:340706. |
| UCSC | uc001lbk.1. human. uc001lbl.1. human. uc009xyf.1. human. |
Organism-specific databases | |
| CTD | 340706. |
| GeneCards | GC10P115990. |
| HGNC | HGNC:24709. VWA2. |
| HPA | HPA037847. |
| neXtProt | NX_Q5GFL6. |
| PharmGKB | PA142670613. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG257441. |
| HOVERGEN | HBG055835. |
| OMA | FPRWEEL. |
| OrthoDB | EOG46T314. |
Gene expression databases | |
| Bgee | Q5GFL6. |
| CleanEx | HS_VWA2. |
| Genevestigator | Q5GFL6. |
Family and domain databases | |
| InterPro | IPR000742. EG-like_dom. IPR013032. EGF-like_CS. IPR002035. VWF_A. [Graphical view] |
| Pfam | PF00008. EGF. 2 hits. PF00092. VWA. 3 hits. [Graphical view] |
| SMART | SM00181. EGF. 2 hits. SM00327. VWA. 3 hits. [Graphical view] |
| PROSITE | PS00022. EGF_1. 1 hit. PS01186. EGF_2. 1 hit. PS50026. EGF_3. 2 hits. PS50234. VWFA. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 340706. |
| NextBio | 98002. |
Entry information
| Entry name | VWA2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5GFL6 Secondary accession number(s): A1A5D4 Q70UZ8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
