Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Shugoshin 1

Gene

SGO1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a central role in chromosome cohesion during mitosis by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms. May act by preventing phosphorylation of the STAG2 subunit of cohesin complex at the centromere, ensuring cohesin persistence at centromere until cohesin cleavage by ESPL1/separase at anaphase. Essential for proper chromosome segregation during mitosis and this function requires interaction with PPP2R1A. Its phosphorylated form is necessary for chromosome congression and for the proper attachment of spindle microtubule to the kinetochore. Necessary for kinetochore localization of PLK1 and CENPF. May play a role in the tension sensing mechanism of the spindle-assembly checkpoint by regulating PLK1 kinetochore affinity. Isoform 3 plays a role in maintaining centriole cohesion involved in controlling spindle pole integrity. Involved in centromeric enrichment of AUKRB in prometaphase.8 Publications

Miscellaneous

Shugoshin is Japanese for guardian spirit (as it is known to be a protector of centromeric cohesin).

GO - Molecular functioni

  • kinase binding Source: MGI

GO - Biological processi

  • attachment of spindle microtubules to kinetochore Source: UniProtKB
  • cell division Source: UniProtKB-KW
  • centriole-centriole cohesion Source: UniProtKB
  • chromosome segregation Source: UniProtKB
  • meiotic chromosome segregation Source: MGI
  • mitotic sister chromatid cohesion, centromeric Source: UniProtKB

Keywordsi

Biological processCell cycle, Cell division, Chromosome partition, Mitosis

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-68877 Mitotic Prometaphase
SIGNORiQ5FBB7

Names & Taxonomyi

Protein namesi
Recommended name:
Shugoshin 1Imported
Alternative name(s):
Serologically defined breast cancer antigen NY-BR-85
Shugoshin-like 1
Gene namesi
Name:SGO1Imported
Synonyms:SGOL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000129810.14
HGNCiHGNC:25088 SGO1
MIMi609168 gene
neXtProtiNX_Q5FBB7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore, Nucleus

Pathology & Biotechi

Involvement in diseasei

Chronic atrial and intestinal dysrhythmia (CAID)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disease characterized by dysregulation of the cardiac sinus node resulting in sick sinus syndrome, in association with chronic intestinal pseudo-obstruction, a disorder of gastrointestinal motility in which intestinal obstruction occurs in the absence of a mechanical obstacle.
See also OMIM:616201
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07270923K → E in CAID; patient fibroblasts exhibit significantly faster cell proliferation than controls; during mitosis the mutant protein is localized in an ordered fashion around the centromeres but display a rather homogeneous cytoplasmic localization pattern. 1 PublicationCorresponds to variant dbSNP:rs199815268EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi14S → A: Loss of phosphorylation and presence of misaligned chromosomes; when associated with A-507. 1 Publication1
Mutagenesisi61N → I: Loss of interaction with PPP2CA and PPP2R1A and loss of centromeric localization. 1 Publication1
Mutagenesisi73S → A: Loss of proper localization to spindle pole and mitotic spindle. Significant increase in split spindle poles. 1 Publication1
Mutagenesisi146T → A: Loss of proper localization to spindle pole and mitotic spindle. Significant increase in split spindle poles. 1 Publication1
Mutagenesisi451P → A: Disrupts interaction with CBX5, loss of localization to centromeres in interphase, no effect on localization to centromeres in mitosis; when associated with A-453 and A-455. 1 Publication1
Mutagenesisi453V → A: Disrupts interaction with CBX5, loss of localization to centromeres in interphase, no effect on localization to centromeres in mitosis; when associated with A-451 and A-455. 1 Publication1
Mutagenesisi455I → A: Disrupts interaction with CBX5, loss of localization to centromeres in interphase, no effect on localization to centromeres in mitosis; when associated with A-451 and A-453. 1 Publication1
Mutagenesisi492K → A: Loss of centromeric localization. 1 Publication1
Mutagenesisi507S → A: Loss of phosphorylation; and presence of misaligned chromosomes; when associated with A-14. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi151648
MalaCardsiSGO1
MIMi616201 phenotype
OpenTargetsiENSG00000129810
PharmGKBiPA134988556

Polymorphism and mutation databases

BioMutaiSGOL1
DMDMi74741474

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000554361 – 561Shugoshin 1Add BLAST561

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei14Phosphoserine; by NEK21 Publication1
Modified residuei256PhosphoserineCombined sources1
Modified residuei436PhosphoserineCombined sources1
Modified residuei507Phosphoserine; by NEK2Combined sources1 Publication1

Post-translational modificationi

Ubiquitinated and degraded during mitotic exit by APC/C-Cdh1.1 Publication
Phosphorylation by NEK2 is essential for chromosome congression in mitosis and for the proper attachment of spindle microtubule to the kinetochore. Phosphorylated by PLK1 and AUKRB.3 Publications

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ5FBB7
MaxQBiQ5FBB7
PaxDbiQ5FBB7
PeptideAtlasiQ5FBB7
PRIDEiQ5FBB7

PTM databases

iPTMnetiQ5FBB7
PhosphoSitePlusiQ5FBB7

Expressioni

Tissue specificityi

Widely expressed. Highly expressed in testis. Expressed in lung, small intestine, breast, liver and placenta. Strongly overexpressed in 90% of breast cancers tested.1 Publication

Developmental stagei

Appears in prophase cells and remains present until metaphase. Strongly decreases at the onset of anaphase and completely disappears at telophase. Not present in interphase cells (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000129810
ExpressionAtlasiQ5FBB7 baseline and differential
GenevisibleiQ5FBB7 HS

Organism-specific databases

HPAiHPA069857

Interactioni

Subunit structurei

Interacts with PPP2CA (or PPP2CB), PPP2R1B, PPP2R5A, PPP2R5B, PPP2R5C, PPP2R5D, PPP2R5E, SET, LRRC59, RBM10 (or RBM5), RPL10A, RPL28, RPL7, RPL7A and RPLP1. Interaction with protein phosphatase 2A occurs most probably through direct binding to the regulatory B56 subunits: PPP2R1B, PPP2R5A, PPP2R5B, PPP2R5C, PPP2R5D, PPP2R5E. Interacts with PPP2R1A and NEK2. Isoform 3 interacts with PLK1. Interacts with CDCA8.5 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • kinase binding Source: MGI

Protein-protein interaction databases

BioGridi127395, 57 interactors
DIPiDIP-36614N
IntActiQ5FBB7, 47 interactors
MINTiQ5FBB7
STRINGi9606.ENSP00000263753

Structurei

Secondary structure

1561
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi51 – 93Combined sources43
Beta strandi448 – 455Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3FGAX-ray2.70D51-96[»]
3Q6SX-ray1.93E/F445-463[»]
4A0IX-ray2.60C/D2-6[»]
ProteinModelPortaliQ5FBB7
SMRiQ5FBB7
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ5FBB7

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 176Necessary for interaction with PPP2CA and PPP2R1A1 PublicationAdd BLAST176

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili7 – 89Sequence analysisAdd BLAST83
Coiled coili273 – 313Sequence analysisAdd BLAST41

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi192 – 200D-box 19
Motifi310 – 312KEN box3
Motifi438 – 446D-box 29
Motifi451 – 455PXVXL/I motif1 Publication5
Motifi457 – 465D-box 39

Domaini

The KEN box and D-box 3 are required for its ubiquitination and degradation.1 Publication

Sequence similaritiesi

Belongs to the shugoshin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IPKX Eukaryota
ENOG4111FBS LUCA
GeneTreeiENSGT00390000014987
HOVERGENiHBG080777
InParanoidiQ5FBB7
KOiK11580
OMAiTPFRQKM
OrthoDBiEOG091G0AX7
PhylomeDBiQ5FBB7
TreeFamiTF334213

Family and domain databases

InterProiView protein in InterPro
IPR028321 Sgo1
IPR011515 Shugoshin_C
IPR011516 Shugoshin_N
PANTHERiPTHR21577:SF3 PTHR21577:SF3, 1 hit
PfamiView protein in Pfam
PF07557 Shugoshin_C, 1 hit
PF07558 Shugoshin_N, 1 hit

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5FBB7-1) [UniParc]FASTAAdd to basket
Also known as: 1EF, SgoL1-A2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKERCLKKS FQDSLEDIKK RMKEKRNKNL AEIGKRRSFI AAPCQIITNT
60 70 80 90 100
STLLKNYQDN NKMLVLALEN EKSKVKEAQD IILQLRKECY YLTCQLYALK
110 120 130 140 150
GKLTSQQTVE PAQNQEICSS GMDPNSDDSS RNLFVKDLPQ IPLEETELPG
160 170 180 190 200
QGESFQIEDQ IPTIPQDTLG VDFDSGEAKS TDNVLPRTVS VRSSLKKHCN
210 220 230 240 250
SICQFDSLDD FETSHLAGKS FEFERVGFLD PLVNMHIPEN VQHNACQWSK
260 270 280 290 300
DQVNLSPKLI QPGTFTKTKE DILESKSEQT KSKQRDTQER KREEKRKANR
310 320 330 340 350
RKSKRMSKYK ENKSENKKTV PQKKMHKSVS SNDAYNFNLE EGVHLTPFRQ
360 370 380 390 400
KVSNDSNREE NNESEVSLCE SSGSGDDSDD LYLPTCKYIQ NPTSNSDRPV
410 420 430 440 450
TRPLAKRALK YTDEKETEGS KPTKTPTTTP PETQQSPHLS LKDITNVSLY
460 470 480 490 500
PVVKIRRLSL SPKKNKASPA VALPKRRCTA SVNYKEPTLA SKLRRGDPFT
510 520 530 540 550
DLCFLNSPIF KQKKDLRRSK KRALEVSPAK EAIFILYYVR EFVSRFPDCR
560
KCKLETHICL R
Length:561
Mass (Da):64,190
Last modified:March 15, 2005 - v1
Checksum:i90CEE0FD2B40CD9C
GO
Isoform 2 (identifier: Q5FBB7-2) [UniParc]FASTAAdd to basket
Also known as: 1GH, SgoL1-B2

The sequence of this isoform differs from the canonical sequence as follows:
     176-176: G → A
     177-428: Missing.

Show »
Length:309
Mass (Da):35,344
Checksum:iA8322EF03909112C
GO
Isoform 3 (identifier: Q5FBB7-3) [UniParc]FASTAAdd to basket
Also known as: 1KL, sSGO1, SgoL1-C2

The sequence of this isoform differs from the canonical sequence as follows:
     159-159: D → A
     160-428: Missing.

Show »
Length:292
Mass (Da):33,501
Checksum:i9E23E55D203774D7
GO
Isoform 4 (identifier: Q5FBB7-4) [UniParc]FASTAAdd to basket
Also known as: 1CD, SgoL1-B1

The sequence of this isoform differs from the canonical sequence as follows:
     176-176: G → A
     177-428: Missing.
     522-561: RALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR → SMKQIQ

Show »
Length:275
Mass (Da):31,276
Checksum:iFF0A4DC6D2F778D5
GO
Isoform 5 (identifier: Q5FBB7-5) [UniParc]FASTAAdd to basket
Also known as: 1AB, SgoL1-C1

The sequence of this isoform differs from the canonical sequence as follows:
     159-159: D → A
     160-428: Missing.
     522-561: RALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR → SMKQIQ

Show »
Length:258
Mass (Da):29,433
Checksum:i402AA77D4FDCAA74
GO
Isoform 6 (identifier: Q5FBB7-6) [UniParc]FASTAAdd to basket
Also known as: 1AB, SgoL1-A1

The sequence of this isoform differs from the canonical sequence as follows:
     522-561: RALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR → SMKQIQ

Show »
Length:527
Mass (Da):60,122
Checksum:i7ADB8B2C0B960A92
GO
Isoform 7 (identifier: Q5FBB7-7) [UniParc]FASTAAdd to basket
Also known as: 1J

The sequence of this isoform differs from the canonical sequence as follows:
     177-522: Missing.

Show »
Length:215
Mass (Da):24,646
Checksum:i6FBC1BCA822DC3F4
GO

Sequence cautioni

The sequence AAH01339 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAH32696 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07270923K → E in CAID; patient fibroblasts exhibit significantly faster cell proliferation than controls; during mitosis the mutant protein is localized in an ordered fashion around the centromeres but display a rather homogeneous cytoplasmic localization pattern. 1 PublicationCorresponds to variant dbSNP:rs199815268EnsemblClinVar.1
Natural variantiVAR_051968171V → A. Corresponds to variant dbSNP:rs6806241Ensembl.1
Natural variantiVAR_051969322Q → P. Corresponds to variant dbSNP:rs9868701Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016790159D → A in isoform 3 and isoform 5. 3 Publications1
Alternative sequenceiVSP_016791160 – 428Missing in isoform 3 and isoform 5. 3 PublicationsAdd BLAST269
Alternative sequenceiVSP_016792176G → A in isoform 2 and isoform 4. 2 Publications1
Alternative sequenceiVSP_016793177 – 522Missing in isoform 7. 1 PublicationAdd BLAST346
Alternative sequenceiVSP_016794177 – 428Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST252
Alternative sequenceiVSP_016795522 – 561RALEV…HICLR → SMKQIQ in isoform 4, isoform 5 and isoform 6. 4 PublicationsAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB190994 mRNA Translation: BAD91318.1
AB193056 mRNA Translation: BAD95529.1
AB193057 mRNA Translation: BAD95530.1
AB193058 mRNA Translation: BAD95531.1
AB193059 mRNA Translation: BAD95532.1
AB193060 mRNA Translation: BAD95533.1
AB193061 mRNA Translation: BAD95534.1
AB193062 mRNA Translation: BAD95535.1
AB193063 mRNA Translation: BAD95536.1
AB193064 mRNA Translation: BAD95537.1
AB193065 mRNA Translation: BAD95538.1
AB193066 mRNA Translation: BAD95539.1
AB187577 mRNA Translation: BAD89587.1
AB187578 mRNA Translation: BAD89588.1
AB187579 mRNA Translation: BAD89589.1
AB187580 mRNA Translation: BAD89590.1
AB187581 mRNA Translation: BAD89591.1
AB187582 mRNA Translation: BAD89592.1
BC001339 mRNA Translation: AAH01339.2 Different initiation.
BC017867 mRNA Translation: AAH17867.1
BC032696 mRNA Translation: AAH32696.1 Different initiation.
AF308299 mRNA Translation: AAG48266.1
CCDSiCCDS2635.1 [Q5FBB7-3]
CCDS33716.1 [Q5FBB7-1]
CCDS46771.1 [Q5FBB7-2]
CCDS46772.1 [Q5FBB7-5]
CCDS46773.1 [Q5FBB7-6]
CCDS46774.1 [Q5FBB7-4]
CCDS56243.1 [Q5FBB7-7]
RefSeqiNP_001012409.1, NM_001012409.3 [Q5FBB7-6]
NP_001012410.1, NM_001012410.4 [Q5FBB7-1]
NP_001012411.1, NM_001012411.3 [Q5FBB7-4]
NP_001012412.1, NM_001012412.4 [Q5FBB7-2]
NP_001012413.1, NM_001012413.3 [Q5FBB7-5]
NP_001186180.1, NM_001199251.2 [Q5FBB7-6]
NP_001186181.1, NM_001199252.2 [Q5FBB7-1]
NP_001186182.1, NM_001199253.2 [Q5FBB7-4]
NP_001186183.1, NM_001199254.2 [Q5FBB7-2]
NP_001186184.1, NM_001199255.2 [Q5FBB7-5]
NP_001186185.1, NM_001199256.2 [Q5FBB7-3]
NP_001186186.1, NM_001199257.2 [Q5FBB7-7]
NP_612493.1, NM_138484.4 [Q5FBB7-3]
XP_011531675.1, XM_011533373.2 [Q5FBB7-1]
XP_011531677.1, XM_011533375.2 [Q5FBB7-1]
XP_011531678.1, XM_011533376.2 [Q5FBB7-1]
XP_011531679.1, XM_011533377.2 [Q5FBB7-1]
UniGeneiHs.105153

Genome annotation databases

EnsembliENST00000263753; ENSP00000263753; ENSG00000129810 [Q5FBB7-1]
ENST00000306698; ENSP00000306581; ENSG00000129810 [Q5FBB7-3]
ENST00000412997; ENSP00000410458; ENSG00000129810 [Q5FBB7-6]
ENST00000417364; ENSP00000394613; ENSG00000129810 [Q5FBB7-4]
ENST00000419233; ENSP00000394625; ENSG00000129810 [Q5FBB7-2]
ENST00000421451; ENSP00000414129; ENSG00000129810 [Q5FBB7-1]
ENST00000425061; ENSP00000414960; ENSG00000129810 [Q5FBB7-2]
ENST00000437051; ENSP00000389034; ENSG00000129810 [Q5FBB7-4]
ENST00000442720; ENSP00000394957; ENSG00000129810 [Q5FBB7-5]
ENST00000443724; ENSP00000413070; ENSG00000129810 [Q5FBB7-7]
ENST00000452020; ENSP00000411200; ENSG00000129810 [Q5FBB7-3]
GeneIDi151648
KEGGihsa:151648
UCSCiuc003cbr.4 human [Q5FBB7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSGO1_HUMAN
AccessioniPrimary (citable) accession number: Q5FBB7
Secondary accession number(s): Q588H5
, Q5FBB4, Q5FBB5, Q5FBB6, Q5FBB8, Q8N579, Q8WVL0, Q9BVA8, Q9H275
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: March 15, 2005
Last modified: May 23, 2018
This is version 130 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health