Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-(1,3)-fucosyltransferase 10

Gene

Fut10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Probable fucosyltransferase.By similarity

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

GO - Molecular functioni

  • alpha-(1->3)-fucosyltransferase activity Source: MGI

GO - Biological processi

  • cerebral cortex radially oriented cell migration Source: MGI
  • neuronal stem cell population maintenance Source: MGI
  • protein glycosylation Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Enzyme and pathway databases

UniPathwayiUPA00378.

Protein family/group databases

CAZyiGT10. Glycosyltransferase Family 10.

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-(1,3)-fucosyltransferase 10 (EC:2.4.1.-)
Alternative name(s):
Fucosyltransferase X
Short name:
Fuc-TX
Short name:
FucT-X
Galactoside 3-L-fucosyltransferase 10
Short name:
Fucosyltransferase 10
Gene namesi
Name:Fut10
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:2384748. Fut10.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 8CytoplasmicSequence analysis8
Transmembranei9 – 31Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST23
Topological domaini32 – 481LumenalSequence analysisAdd BLAST450

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002990031 – 481Alpha-(1,3)-fucosyltransferase 10Add BLAST481

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi110N-linked (GlcNAc...)Sequence analysis1
Glycosylationi168N-linked (GlcNAc...)Sequence analysis1
Glycosylationi318N-linked (GlcNAc...)Sequence analysis1
Glycosylationi468N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ5F2L2.
PeptideAtlasiQ5F2L2.
PRIDEiQ5F2L2.

PTM databases

iPTMnetiQ5F2L2.
PhosphoSitePlusiQ5F2L2.

Expressioni

Tissue specificityi

Widely expressed, with a higher expression in liver and thymus.1 Publication

Gene expression databases

BgeeiENSMUSG00000046152.
CleanExiMM_FUT10.
GenevisibleiQ5F2L2. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000069816.

Structurei

3D structure databases

ProteinModelPortaliQ5F2L2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 10 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2619. Eukaryota.
ENOG410ZIMX. LUCA.
GeneTreeiENSGT00680000099679.
HOGENOMiHOG000006538.
HOVERGENiHBG055521.
InParanoidiQ5F2L2.
KOiK09669.
OMAiHKPVITL.
OrthoDBiEOG091G064Z.
PhylomeDBiQ5F2L2.
TreeFamiTF316348.

Family and domain databases

InterProiIPR017176. Alpha-1_3-FUT_met.
IPR031481. Glyco_tran_10_N.
IPR001503. Glyco_trans_10.
[Graphical view]
PANTHERiPTHR11929. PTHR11929. 2 hits.
PfamiPF17039. Glyco_tran_10_N. 1 hit.
PF00852. Glyco_transf_10. 1 hit.
[Graphical view]
PIRSFiPIRSF037332. Alpha1_3FUT_met. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5F2L2-1) [UniParc]FASTAAdd to basket
Also known as: Fut10A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVRFQRRKLL ASCLCVTATV FLMVTLQVVV ELGKFERKKL KDSNVQDGHR
60 70 80 90 100
DVEGEPKHLE PFPEKEALAL AGRTKVDAGS YPIVLWWSPL TGETGRLGQC
110 120 130 140 150
GADACFFTIN RTFQHHPMTR AFLFYGTDFN IDSLPLPREA HHDWALFHEE
160 170 180 190 200
SPKNNYKLFH KPVITLFNHT ATFSRHSHLP LTTQYLEGVD VLKSLRYLVP
210 220 230 240 250
LQAKNNLRQK LAPLVYVQSD CDPPSDRDSY VRELMAYIEV DSYGECLQNR
260 270 280 290 300
DLPQQLKNPA SMDADAFYRV IAQYKFILAF ENAVCDDYIT EKFWRPLKLG
310 320 330 340 350
VVPVYYGSPT IADWLPSNRS AILVSEFSHP RELASFIRRL DYDDGLYETY
360 370 380 390 400
VEWKLKGKIS NQRLLTALNE REWGVQDINQ DNYIDSFECM VCRRVWANSR
410 420 430 440 450
LQEQGLPPKQ WKADVSHLHC PEPALFTFSS PASPALRGRS LRELWLPSFQ
460 470 480
QSKKEAQALR WLVDRNQNFS SEEFWALVFK D
Length:481
Mass (Da):55,707
Last modified:March 15, 2005 - v1
Checksum:i4CEC3DB4469F754D
GO
Isoform 2 (identifier: Q5F2L2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     405-481: GLPPKQWKAD...EEFWALVFKD → VSEWKSGGWHGPSLCVVLVFLLWWLPATGLYS

Show »
Length:436
Mass (Da):50,386
Checksum:i16A655F1027F8484
GO
Isoform 3 (identifier: Q5F2L2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-136: TDFNIDSLPL → LTTQTMEGRC
     137-481: Missing.

Show »
Length:136
Mass (Da):15,378
Checksum:i2E2F4E186227C455
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti335S → N in AAH22579 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027507127 – 136TDFNIDSLPL → LTTQTMEGRC in isoform 3. 1 Publication10
Alternative sequenceiVSP_027508137 – 481Missing in isoform 3. 1 PublicationAdd BLAST345
Alternative sequenceiVSP_027509405 – 481GLPPK…LVFKD → VSEWKSGGWHGPSLCVVLVF LLWWLPATGLYS in isoform 2. 1 PublicationAdd BLAST77

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ880009 mRNA. Translation: CAI53944.1.
AK083041 mRNA. Translation: BAC38741.1.
AK147136 mRNA. Translation: BAE27706.1.
AK169153 mRNA. Translation: BAE40932.1.
BC022579 mRNA. Translation: AAH22579.1.
BC030474 mRNA. Translation: AAH30474.1.
BC062113 mRNA. Translation: AAH62113.1.
CCDSiCCDS22223.1. [Q5F2L2-1]
CCDS52536.1. [Q5F2L2-2]
CCDS72111.1. [Q5F2L2-3]
RefSeqiNP_001012535.1. NM_001012517.5. [Q5F2L2-1]
NP_001273351.1. NM_001286422.1. [Q5F2L2-1]
NP_001273353.1. NM_001286424.1. [Q5F2L2-2]
NP_001273354.1. NM_001286425.1. [Q5F2L2-3]
NP_598922.1. NM_134161.3. [Q5F2L2-2]
UniGeneiMm.334477.

Genome annotation databases

EnsembliENSMUST00000066173; ENSMUSP00000069816; ENSMUSG00000046152. [Q5F2L2-1]
ENSMUST00000110527; ENSMUSP00000106156; ENSMUSG00000046152. [Q5F2L2-3]
ENSMUST00000161502; ENSMUSP00000125265; ENSMUSG00000046152. [Q5F2L2-1]
ENSMUST00000161788; ENSMUSP00000124437; ENSMUSG00000046152. [Q5F2L2-2]
GeneIDi171167.
KEGGimmu:171167.
UCSCiuc009ljj.2. mouse. [Q5F2L2-2]
uc009ljk.2. mouse. [Q5F2L2-1]
uc012gby.2. mouse. [Q5F2L2-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - GTase

Fucosyltransferase 10

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ880009 mRNA. Translation: CAI53944.1.
AK083041 mRNA. Translation: BAC38741.1.
AK147136 mRNA. Translation: BAE27706.1.
AK169153 mRNA. Translation: BAE40932.1.
BC022579 mRNA. Translation: AAH22579.1.
BC030474 mRNA. Translation: AAH30474.1.
BC062113 mRNA. Translation: AAH62113.1.
CCDSiCCDS22223.1. [Q5F2L2-1]
CCDS52536.1. [Q5F2L2-2]
CCDS72111.1. [Q5F2L2-3]
RefSeqiNP_001012535.1. NM_001012517.5. [Q5F2L2-1]
NP_001273351.1. NM_001286422.1. [Q5F2L2-1]
NP_001273353.1. NM_001286424.1. [Q5F2L2-2]
NP_001273354.1. NM_001286425.1. [Q5F2L2-3]
NP_598922.1. NM_134161.3. [Q5F2L2-2]
UniGeneiMm.334477.

3D structure databases

ProteinModelPortaliQ5F2L2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000069816.

Protein family/group databases

CAZyiGT10. Glycosyltransferase Family 10.

PTM databases

iPTMnetiQ5F2L2.
PhosphoSitePlusiQ5F2L2.

Proteomic databases

PaxDbiQ5F2L2.
PeptideAtlasiQ5F2L2.
PRIDEiQ5F2L2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000066173; ENSMUSP00000069816; ENSMUSG00000046152. [Q5F2L2-1]
ENSMUST00000110527; ENSMUSP00000106156; ENSMUSG00000046152. [Q5F2L2-3]
ENSMUST00000161502; ENSMUSP00000125265; ENSMUSG00000046152. [Q5F2L2-1]
ENSMUST00000161788; ENSMUSP00000124437; ENSMUSG00000046152. [Q5F2L2-2]
GeneIDi171167.
KEGGimmu:171167.
UCSCiuc009ljj.2. mouse. [Q5F2L2-2]
uc009ljk.2. mouse. [Q5F2L2-1]
uc012gby.2. mouse. [Q5F2L2-3]

Organism-specific databases

CTDi84750.
MGIiMGI:2384748. Fut10.

Phylogenomic databases

eggNOGiKOG2619. Eukaryota.
ENOG410ZIMX. LUCA.
GeneTreeiENSGT00680000099679.
HOGENOMiHOG000006538.
HOVERGENiHBG055521.
InParanoidiQ5F2L2.
KOiK09669.
OMAiHKPVITL.
OrthoDBiEOG091G064Z.
PhylomeDBiQ5F2L2.
TreeFamiTF316348.

Enzyme and pathway databases

UniPathwayiUPA00378.

Miscellaneous databases

PROiQ5F2L2.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000046152.
CleanExiMM_FUT10.
GenevisibleiQ5F2L2. MM.

Family and domain databases

InterProiIPR017176. Alpha-1_3-FUT_met.
IPR031481. Glyco_tran_10_N.
IPR001503. Glyco_trans_10.
[Graphical view]
PANTHERiPTHR11929. PTHR11929. 2 hits.
PfamiPF17039. Glyco_tran_10_N. 1 hit.
PF00852. Glyco_transf_10. 1 hit.
[Graphical view]
PIRSFiPIRSF037332. Alpha1_3FUT_met. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiFUT10_MOUSE
AccessioniPrimary (citable) accession number: Q5F2L2
Secondary accession number(s): Q8C457, Q8K0S3, Q8R247
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: March 15, 2005
Last modified: November 2, 2016
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.