Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-(1,3)-fucosyltransferase 10

Gene

Fut10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Probable fucosyltransferase.By similarity

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

GO - Molecular functioni

  • alpha-(1->3)-fucosyltransferase activity Source: MGI

GO - Biological processi

  • cerebral cortex radially oriented cell migration Source: MGI
  • neuronal stem cell population maintenance Source: MGI
  • protein glycosylation Source: UniProtKB-UniPathway

Keywordsi

Molecular functionGlycosyltransferase, Transferase

Enzyme and pathway databases

UniPathwayiUPA00378

Protein family/group databases

CAZyiGT10 Glycosyltransferase Family 10

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-(1,3)-fucosyltransferase 10 (EC:2.4.1.-)
Alternative name(s):
Fucosyltransferase X
Short name:
Fuc-TX
Short name:
FucT-X
Galactoside 3-L-fucosyltransferase 10
Short name:
Fucosyltransferase 10
Gene namesi
Name:Fut10
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:2384748 Fut10

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 8CytoplasmicSequence analysis8
Transmembranei9 – 31Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST23
Topological domaini32 – 481LumenalSequence analysisAdd BLAST450

Keywords - Cellular componenti

Golgi apparatus, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002990031 – 481Alpha-(1,3)-fucosyltransferase 10Add BLAST481

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi110N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi168N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi318N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi468N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ5F2L2
PeptideAtlasiQ5F2L2
PRIDEiQ5F2L2

PTM databases

iPTMnetiQ5F2L2
PhosphoSitePlusiQ5F2L2

Expressioni

Tissue specificityi

Widely expressed, with a higher expression in liver and thymus.1 Publication

Gene expression databases

BgeeiENSMUSG00000046152
CleanExiMM_FUT10
GenevisibleiQ5F2L2 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000069816

Structurei

3D structure databases

ProteinModelPortaliQ5F2L2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 10 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2619 Eukaryota
ENOG410ZIMX LUCA
GeneTreeiENSGT00680000099679
HOGENOMiHOG000006538
HOVERGENiHBG055521
InParanoidiQ5F2L2
KOiK09669
OMAiYGTDFNI
OrthoDBiEOG091G064Z
PhylomeDBiQ5F2L2
TreeFamiTF316348

Family and domain databases

Gene3Di3.40.50.11660, 1 hit
InterProiView protein in InterPro
IPR017176 Alpha-1_3-FUT_met
IPR031481 Glyco_tran_10_N
IPR001503 Glyco_trans_10
IPR038577 GT10-like_sf
PANTHERiPTHR11929 PTHR11929, 1 hit
PfamiView protein in Pfam
PF17039 Glyco_tran_10_N, 1 hit
PF00852 Glyco_transf_10, 1 hit
PIRSFiPIRSF037332 Alpha1_3FUT_met, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5F2L2-1) [UniParc]FASTAAdd to basket
Also known as: Fut10A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVRFQRRKLL ASCLCVTATV FLMVTLQVVV ELGKFERKKL KDSNVQDGHR
60 70 80 90 100
DVEGEPKHLE PFPEKEALAL AGRTKVDAGS YPIVLWWSPL TGETGRLGQC
110 120 130 140 150
GADACFFTIN RTFQHHPMTR AFLFYGTDFN IDSLPLPREA HHDWALFHEE
160 170 180 190 200
SPKNNYKLFH KPVITLFNHT ATFSRHSHLP LTTQYLEGVD VLKSLRYLVP
210 220 230 240 250
LQAKNNLRQK LAPLVYVQSD CDPPSDRDSY VRELMAYIEV DSYGECLQNR
260 270 280 290 300
DLPQQLKNPA SMDADAFYRV IAQYKFILAF ENAVCDDYIT EKFWRPLKLG
310 320 330 340 350
VVPVYYGSPT IADWLPSNRS AILVSEFSHP RELASFIRRL DYDDGLYETY
360 370 380 390 400
VEWKLKGKIS NQRLLTALNE REWGVQDINQ DNYIDSFECM VCRRVWANSR
410 420 430 440 450
LQEQGLPPKQ WKADVSHLHC PEPALFTFSS PASPALRGRS LRELWLPSFQ
460 470 480
QSKKEAQALR WLVDRNQNFS SEEFWALVFK D
Length:481
Mass (Da):55,707
Last modified:March 15, 2005 - v1
Checksum:i4CEC3DB4469F754D
GO
Isoform 2 (identifier: Q5F2L2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     405-481: GLPPKQWKAD...EEFWALVFKD → VSEWKSGGWHGPSLCVVLVFLLWWLPATGLYS

Show »
Length:436
Mass (Da):50,386
Checksum:i16A655F1027F8484
GO
Isoform 3 (identifier: Q5F2L2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-136: TDFNIDSLPL → LTTQTMEGRC
     137-481: Missing.

Show »
Length:136
Mass (Da):15,378
Checksum:i2E2F4E186227C455
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti335S → N in AAH22579 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027507127 – 136TDFNIDSLPL → LTTQTMEGRC in isoform 3. 1 Publication10
Alternative sequenceiVSP_027508137 – 481Missing in isoform 3. 1 PublicationAdd BLAST345
Alternative sequenceiVSP_027509405 – 481GLPPK…LVFKD → VSEWKSGGWHGPSLCVVLVF LLWWLPATGLYS in isoform 2. 1 PublicationAdd BLAST77

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ880009 mRNA Translation: CAI53944.1
AK083041 mRNA Translation: BAC38741.1
AK147136 mRNA Translation: BAE27706.1
AK169153 mRNA Translation: BAE40932.1
BC022579 mRNA Translation: AAH22579.1
BC030474 mRNA Translation: AAH30474.1
BC062113 mRNA Translation: AAH62113.1
CCDSiCCDS22223.1 [Q5F2L2-1]
CCDS52536.1 [Q5F2L2-2]
CCDS72111.1 [Q5F2L2-3]
RefSeqiNP_001012535.1, NM_001012517.5 [Q5F2L2-1]
NP_001273351.1, NM_001286422.1 [Q5F2L2-1]
NP_001273353.1, NM_001286424.1 [Q5F2L2-2]
NP_001273354.1, NM_001286425.1 [Q5F2L2-3]
NP_598922.1, NM_134161.3 [Q5F2L2-2]
UniGeneiMm.334477

Genome annotation databases

EnsembliENSMUST00000066173; ENSMUSP00000069816; ENSMUSG00000046152 [Q5F2L2-1]
ENSMUST00000110527; ENSMUSP00000106156; ENSMUSG00000046152 [Q5F2L2-3]
ENSMUST00000161502; ENSMUSP00000125265; ENSMUSG00000046152 [Q5F2L2-1]
ENSMUST00000161788; ENSMUSP00000124437; ENSMUSG00000046152 [Q5F2L2-2]
GeneIDi171167
KEGGimmu:171167
UCSCiuc009ljj.2 mouse [Q5F2L2-2]
uc009ljk.2 mouse [Q5F2L2-1]
uc012gby.2 mouse [Q5F2L2-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFUT10_MOUSE
AccessioniPrimary (citable) accession number: Q5F2L2
Secondary accession number(s): Q8C457, Q8K0S3, Q8R247
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: March 15, 2005
Last modified: March 28, 2018
This is version 103 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health