Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-(1,3)-fucosyltransferase 10

Gene

Fut10

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Probable fucosyltransferase.By similarity

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Enzyme and pathway databases

UniPathwayiUPA00378.

Protein family/group databases

CAZyiGT10. Glycosyltransferase Family 10.

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-(1,3)-fucosyltransferase 10 (EC:2.4.1.-)
Alternative name(s):
Fucosyltransferase X
Short name:
Fuc-TX
Short name:
FucT-X
Galactoside 3-L-fucosyltransferase 10
Short name:
Fucosyltransferase 10
Gene namesi
Name:Fut10
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi1359164. Fut10.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 88CytoplasmicSequence analysis
Transmembranei9 – 3123Helical; Signal-anchor for type II membrane proteinSequence analysisAdd
BLAST
Topological domaini32 – 483452LumenalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 483483Alpha-(1,3)-fucosyltransferase 10PRO_0000299004Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi110 – 1101N-linked (GlcNAc...)Sequence analysis
Glycosylationi168 – 1681N-linked (GlcNAc...)Sequence analysis
Glycosylationi318 – 3181N-linked (GlcNAc...)Sequence analysis
Glycosylationi468 – 4681N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ5F2L1.
PRIDEiQ5F2L1.

Structurei

3D structure databases

ProteinModelPortaliQ5F2L1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 10 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2619. Eukaryota.
ENOG410ZIMX. LUCA.
HOVERGENiHBG055521.
InParanoidiQ5F2L1.
KOiK09669.
PhylomeDBiQ5F2L1.

Family and domain databases

InterProiIPR017176. Alpha-1_3-FUT_met.
IPR031481. Glyco_tran_10_N.
IPR001503. Glyco_trans_10.
[Graphical view]
PANTHERiPTHR11929. PTHR11929. 2 hits.
PfamiPF17039. Glyco_tran_10_N. 1 hit.
PF00852. Glyco_transf_10. 1 hit.
[Graphical view]
PIRSFiPIRSF037332. Alpha1_3FUT_met. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5F2L1-1) [UniParc]FASTAAdd to basket

Also known as: Fut10A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVRIPRRKLL PSCLCMTATV FLMVTVQVLV ELGKFERKKF KNSDLQDGQK
60 70 80 90 100
DVEGDPKHLN PLPKKDALAL SGRNKVDAGS YPIVLWWSPL TGETGRLGQC
110 120 130 140 150
GADACFFTIN RTFQHHPMTK AFLFYGTDFN IDSLPLPRKA HHDWALFHEE
160 170 180 190 200
SPKNNYKLFH KPVITLFNHT ATFSRHSDLP LTTQYLESVE VLKSLRYLVP
210 220 230 240 250
LQSKNNLRQK LAPLVYVQSD CDPPSDRDSY VRELMAYIEV DSYGECLQNK
260 270 280 290 300
HLPQQLKNPA SMDADAFYRV LAQYKFILAF ENAVCDDYIT EKFWRPLKLG
310 320 330 340 350
VVPVYYGSPT IADWLPSNRS AILVSEFSHP RELASFIRRL DYDDGLYETY
360 370 380 390 400
VEWKLKGEIS NQRLLTALRE REWGVQDINQ DNYIDTFECM VCRRVWANRR
410 420 430 440 450
LQEQGLPPKQ WKADVSHLHC PEPTLFAFSS PASPALRGRS LRELWLPSFQ
460 470 480
QSKKEAQALR WLVDRNQNFS SEEFWALVFK DSF
Length:483
Mass (Da):56,025
Last modified:March 15, 2005 - v1
Checksum:iB31AA416A6CB2D4B
GO
Isoform 2 (identifier: Q5F2L1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     405-483: GLPPKQWKAD...FWALVFKDSF → VSGWKSGGGRGLSLGVVLVFLLWLLPATVLHS

Show »
Length:436
Mass (Da):50,201
Checksum:iFF996F931B8E0FBC
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei405 – 48379GLPPK…FKDSF → VSGWKSGGGRGLSLGVVLVF LLWLLPATVLHS in isoform 2. 1 PublicationVSP_027510Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ880010 mRNA. Translation: CAI53945.1.
AJ879584 mRNA. Translation: CAI52074.1.
RefSeqiNP_001012360.1. NM_001012360.1. [Q5F2L1-2]
UniGeneiRn.137595.

Genome annotation databases

GeneIDi497619.
KEGGirno:497619.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ880010 mRNA. Translation: CAI53945.1.
AJ879584 mRNA. Translation: CAI52074.1.
RefSeqiNP_001012360.1. NM_001012360.1. [Q5F2L1-2]
UniGeneiRn.137595.

3D structure databases

ProteinModelPortaliQ5F2L1.
ModBaseiSearch...
MobiDBiSearch...

Protein family/group databases

CAZyiGT10. Glycosyltransferase Family 10.

Proteomic databases

PaxDbiQ5F2L1.
PRIDEiQ5F2L1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi497619.
KEGGirno:497619.

Organism-specific databases

CTDi84750.
RGDi1359164. Fut10.

Phylogenomic databases

eggNOGiKOG2619. Eukaryota.
ENOG410ZIMX. LUCA.
HOVERGENiHBG055521.
InParanoidiQ5F2L1.
KOiK09669.
PhylomeDBiQ5F2L1.

Enzyme and pathway databases

UniPathwayiUPA00378.

Miscellaneous databases

PROiQ5F2L1.

Family and domain databases

InterProiIPR017176. Alpha-1_3-FUT_met.
IPR031481. Glyco_tran_10_N.
IPR001503. Glyco_trans_10.
[Graphical view]
PANTHERiPTHR11929. PTHR11929. 2 hits.
PfamiPF17039. Glyco_tran_10_N. 1 hit.
PF00852. Glyco_transf_10. 1 hit.
[Graphical view]
PIRSFiPIRSF037332. Alpha1_3FUT_met. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "Phylogeny of fucosyltransferases."
    Martinez-Duncker I., Oriol R., Mollicone R.
    Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: Wistar.

Entry informationi

Entry nameiFUT10_RAT
AccessioniPrimary (citable) accession number: Q5F2L1
Secondary accession number(s): Q5F2N5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: March 15, 2005
Last modified: June 8, 2016
This is version 67 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.