SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5F2E7

- NUFP2_MOUSE

UniProt

Q5F2E7 - NUFP2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Nuclear fragile X mental retardation-interacting protein 2
Gene
Nufip2, Kiaa1321
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Binds RNA By similarity.

GO - Molecular functioni

  1. RNA binding Source: HGNC
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear fragile X mental retardation-interacting protein 2
Alternative name(s):
82 kDa FMRP-interacting protein
Short name:
82-FIP
FMRP-interacting protein 2
Gene namesi
Name:Nufip2
Synonyms:Kiaa1321
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:1915814. Nufip2.

Subcellular locationi

Nucleus. Cytoplasm
Note: Localized in both nucleus and cytoplasm in most neurons. In the cortex, distributed in a diffuse way in the nucleus and in the cytoplasm. Localized in the cytoplasm in neurons of the dentate gyrus in the olfactive bulb, in the ependymal epithelium and in the granular layer of the cerebellum. In Purkinje cells, distributed in both cell compartments and in nuclear dots adjacent to the nucleolus.1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HGNC
  2. nucleus Source: HGNC
  3. polysomal ribosome Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 692692Nuclear fragile X mental retardation-interacting protein 2
PRO_0000245522Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei88 – 881Phosphothreonine By similarity
Modified residuei113 – 1131Phosphoserine By similarity
Modified residuei114 – 1141Phosphoserine By similarity
Modified residuei213 – 2131Phosphoserine1 Publication
Modified residuei215 – 2151Phosphoserine1 Publication
Modified residuei219 – 2191Phosphotyrosine By similarity
Modified residuei220 – 2201Phosphothreonine By similarity
Modified residuei221 – 2211Phosphothreonine By similarity
Modified residuei376 – 3761Phosphoserine By similarity
Modified residuei569 – 5691Phosphothreonine By similarity
Modified residuei570 – 5701Phosphoserine By similarity
Modified residuei626 – 6261Phosphoserine By similarity
Modified residuei630 – 6301Phosphothreonine By similarity
Modified residuei634 – 6341Phosphoserine By similarity
Modified residuei649 – 6491Phosphoserine3 Publications
Modified residuei652 – 6521Phosphoserine By similarity
Modified residuei689 – 6891Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ5F2E7.
PaxDbiQ5F2E7.
PRIDEiQ5F2E7.

PTM databases

PhosphoSiteiQ5F2E7.

Expressioni

Gene expression databases

BgeeiQ5F2E7.
GenevestigatoriQ5F2E7.

Interactioni

Subunit structurei

Interacts with FMRP By similarity.

Protein-protein interaction databases

BioGridi212929. 1 interaction.
STRINGi10090.ENSMUSP00000049412.

Structurei

3D structure databases

ProteinModelPortaliQ5F2E7.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi12 – 6150His-rich
Add
BLAST
Compositional biasi373 – 41442Ser-rich
Add
BLAST

Phylogenomic databases

eggNOGiopiNOG06224.
GeneTreeiENSGT00440000038328.
HOGENOMiHOG000220869.
HOVERGENiHBG065794.
OMAiKEMESVW.
OrthoDBiEOG71RXJ4.
PhylomeDBiQ5F2E7.
TreeFamiTF332832.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5F2E7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEEKPGQPQP QHHHSHHHPH HHPQQQQQQQ SHHHHHYYFY NHSHNHHHHH    50
HHQQPHQYLQ HGAEGSPKAQ PKPLKHEQKH TLQQHQETPK KKTGYGEING 100
NAGEREISLK SLSSDEATNP ISRVLNGNQQ VVETSLKQTV KTSTFGKAGI 150
KTKNFIQKNS MDKKNGKSYE NKSGETQAVD KTDTIAIPNG VITSSSGYIT 200
NGYMSKGADN DGSGSESGYT TPKKRKARRN SAKGCENLNL VQDKIMQETS 250
VPALKQGLET LKPDYSEQKG MRVDGSKPIW KYETGPGGTS RGKPAMGDVL 300
RKSSDIKPGL SSKKFDDRPK GKHASAAASK EDSWTLFKPP PVFPVDNSSA 350
KIVPKISYAS KVKENLNKTV QNSSVSPSSS SSSSSTGETQ TQSSSRLSQV 400
PMSALKSVTS ASFSNGPVLA GTDGSVYPSG GQPLLTTAAN TLTPISTGTD 450
SVLQDMSLAS AAVEQIKSSL FIYPSNMQTV LLSAQVDLPS QTDQQNLGDI 500
FQNQWGLSFI NEPSAGPETV IGKSSDHKVM EVTFQGEYPA TLVSQGAEII 550
PSGTEHPVFP KAYELEKRTS PQVLGHILKP GTTESGALSL DPSHIGDLQK 600
ADTSSQGALV FLSKDYEIEN QNPLASPTNT LLGSAKEQRY QRGLERNDSW 650
GSFDLRAAIV YHTKEMESIW NLQKQDPKRI ITYNEAMDSP DQ 692
Length:692
Mass (Da):75,657
Last modified:March 15, 2005 - v1
Checksum:i3E295AC111814564
GO
Isoform 2 (identifier: Q5F2E7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     676-692: DPKRIITYNEAMDSPDQ → VFCLCVYMYTYVHHVMSLHGRERTLDPLELALHWS

Note: No experimental confirmation available.

Show »
Length:710
Mass (Da):77,885
Checksum:i3123F4711F98E38B
GO

Sequence cautioni

The sequence BAC65776.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei676 – 69217DPKRI…DSPDQ → VFCLCVYMYTYVHHVMSLHG RERTLDPLELALHWS in isoform 2.
VSP_019729Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti52 – 521Missing in BAE42015. 1 Publication
Sequence conflicti57 – 571Q → R in BAE42015. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK122494 mRNA. Translation: BAC65776.1. Different initiation.
AK132603 mRNA. Translation: BAE21256.1.
AK152336 mRNA. Translation: BAE31134.1.
AK160601 mRNA. Translation: BAE35905.1.
AK170764 mRNA. Translation: BAE42015.1.
AL591136 Genomic DNA. Translation: CAI51880.1.
CCDSiCCDS25083.1. [Q5F2E7-1]
RefSeqiNP_001019376.1. NM_001024205.2. [Q5F2E7-1]
XP_006534125.1. XM_006534062.1. [Q5F2E7-1]
UniGeneiMm.428996.

Genome annotation databases

EnsembliENSMUST00000100802; ENSMUSP00000098365; ENSMUSG00000037857. [Q5F2E7-1]
ENSMUST00000181023; ENSMUSP00000137922; ENSMUSG00000037857. [Q5F2E7-2]
GeneIDi68564.
KEGGimmu:68564.
UCSCiuc007khd.2. mouse. [Q5F2E7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK122494 mRNA. Translation: BAC65776.1 . Different initiation.
AK132603 mRNA. Translation: BAE21256.1 .
AK152336 mRNA. Translation: BAE31134.1 .
AK160601 mRNA. Translation: BAE35905.1 .
AK170764 mRNA. Translation: BAE42015.1 .
AL591136 Genomic DNA. Translation: CAI51880.1 .
CCDSi CCDS25083.1. [Q5F2E7-1 ]
RefSeqi NP_001019376.1. NM_001024205.2. [Q5F2E7-1 ]
XP_006534125.1. XM_006534062.1. [Q5F2E7-1 ]
UniGenei Mm.428996.

3D structure databases

ProteinModelPortali Q5F2E7.
ModBasei Search...

Protein-protein interaction databases

BioGridi 212929. 1 interaction.
STRINGi 10090.ENSMUSP00000049412.

PTM databases

PhosphoSitei Q5F2E7.

Proteomic databases

MaxQBi Q5F2E7.
PaxDbi Q5F2E7.
PRIDEi Q5F2E7.

Protocols and materials databases

DNASUi 68564.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000100802 ; ENSMUSP00000098365 ; ENSMUSG00000037857 . [Q5F2E7-1 ]
ENSMUST00000181023 ; ENSMUSP00000137922 ; ENSMUSG00000037857 . [Q5F2E7-2 ]
GeneIDi 68564.
KEGGi mmu:68564.
UCSCi uc007khd.2. mouse. [Q5F2E7-1 ]

Organism-specific databases

CTDi 57532.
MGIi MGI:1915814. Nufip2.
Rougei Search...

Phylogenomic databases

eggNOGi opiNOG06224.
GeneTreei ENSGT00440000038328.
HOGENOMi HOG000220869.
HOVERGENi HBG065794.
OMAi KEMESVW.
OrthoDBi EOG71RXJ4.
PhylomeDBi Q5F2E7.
TreeFami TF332832.

Miscellaneous databases

NextBioi 327462.
PROi Q5F2E7.
SOURCEi Search...

Gene expression databases

Bgeei Q5F2E7.
Genevestigatori Q5F2E7.

Family and domain databases

ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J and NOD.
    Tissue: Bone marrow, Dendritic cell, Embryo and Head.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "82-FIP, a novel FMRP (fragile X mental retardation protein) interacting protein, shows a cell cycle-dependent intracellular localization."
    Bardoni B., Castets M., Huot M.-E., Schenck A., Adinolfi S., Corbin F., Pastore A., Khandjian E.W., Mandel J.-L.
    Hum. Mol. Genet. 12:1689-1698(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic brain.
  6. "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations."
    Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M.
    Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain cortex.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-213; SER-215 AND SER-649, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  8. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-649, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
    Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
    Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-649, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.

Entry informationi

Entry nameiNUFP2_MOUSE
AccessioniPrimary (citable) accession number: Q5F2E7
Secondary accession number(s): Q3TCE2, Q3V195, Q80TF1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: March 15, 2005
Last modified: July 9, 2014
This is version 73 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi