Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear fragile X mental retardation-interacting protein 2

Gene

Nufip2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Binds RNA.By similarity

GO - Molecular functioni

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear fragile X mental retardation-interacting protein 2
Alternative name(s):
82 kDa FMRP-interacting protein
Short name:
82-FIP
FMRP-interacting protein 2
Gene namesi
Name:Nufip2
Synonyms:Kiaa1321
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1915814. Nufip2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002455221 – 692Nuclear fragile X mental retardation-interacting protein 2Add BLAST692

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei88PhosphothreonineBy similarity1
Modified residuei113PhosphoserineCombined sources1
Modified residuei114PhosphoserineBy similarity1
Cross-linki147Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei213PhosphoserineCombined sources1
Modified residuei215PhosphoserineCombined sources1
Modified residuei219PhosphotyrosineBy similarity1
Modified residuei220PhosphothreonineBy similarity1
Modified residuei221PhosphothreonineBy similarity1
Modified residuei291Omega-N-methylarginineBy similarity1
Modified residuei304PhosphoserineBy similarity1
Cross-linki307Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei376PhosphoserineBy similarity1
Modified residuei569PhosphothreonineBy similarity1
Modified residuei570PhosphoserineCombined sources1
Modified residuei589PhosphoserineBy similarity1
Modified residuei605PhosphoserineBy similarity1
Modified residuei626PhosphoserineCombined sources1
Modified residuei630PhosphothreonineBy similarity1
Modified residuei634PhosphoserineBy similarity1
Modified residuei649PhosphoserineCombined sources1
Modified residuei652PhosphoserineCombined sources1
Modified residuei689PhosphoserineBy similarity1

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ5F2E7.
PaxDbiQ5F2E7.
PeptideAtlasiQ5F2E7.
PRIDEiQ5F2E7.

PTM databases

iPTMnetiQ5F2E7.
PhosphoSitePlusiQ5F2E7.

Expressioni

Gene expression databases

BgeeiENSMUSG00000037857.
GenevisibleiQ5F2E7. MM.

Interactioni

Subunit structurei

Interacts with FMR1 (via N-terminus) (PubMed:12837692). Interacts with DDX6 (By similarity).By similarity1 Publication

Protein-protein interaction databases

BioGridi212929. 3 interactors.
IntActiQ5F2E7. 1 interactor.
STRINGi10090.ENSMUSP00000098365.

Structurei

3D structure databases

ProteinModelPortaliQ5F2E7.
SMRiQ5F2E7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi12 – 61His-richAdd BLAST50
Compositional biasi373 – 414Ser-richAdd BLAST42

Phylogenomic databases

eggNOGiENOG410IGEW. Eukaryota.
ENOG41102P5. LUCA.
GeneTreeiENSGT00440000038328.
HOGENOMiHOG000220869.
HOVERGENiHBG065794.
InParanoidiQ5F2E7.
OMAiEMESVWN.
OrthoDBiEOG091G040J.
PhylomeDBiQ5F2E7.
TreeFamiTF332832.

Family and domain databases

InterProiIPR032747. NUFIP2.
[Graphical view]
PANTHERiPTHR28333. PTHR28333. 1 hit.
PfamiPF15293. NUFIP2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5F2E7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEKPGQPQP QHHHSHHHPH HHPQQQQQQQ SHHHHHYYFY NHSHNHHHHH
60 70 80 90 100
HHQQPHQYLQ HGAEGSPKAQ PKPLKHEQKH TLQQHQETPK KKTGYGEING
110 120 130 140 150
NAGEREISLK SLSSDEATNP ISRVLNGNQQ VVETSLKQTV KTSTFGKAGI
160 170 180 190 200
KTKNFIQKNS MDKKNGKSYE NKSGETQAVD KTDTIAIPNG VITSSSGYIT
210 220 230 240 250
NGYMSKGADN DGSGSESGYT TPKKRKARRN SAKGCENLNL VQDKIMQETS
260 270 280 290 300
VPALKQGLET LKPDYSEQKG MRVDGSKPIW KYETGPGGTS RGKPAMGDVL
310 320 330 340 350
RKSSDIKPGL SSKKFDDRPK GKHASAAASK EDSWTLFKPP PVFPVDNSSA
360 370 380 390 400
KIVPKISYAS KVKENLNKTV QNSSVSPSSS SSSSSTGETQ TQSSSRLSQV
410 420 430 440 450
PMSALKSVTS ASFSNGPVLA GTDGSVYPSG GQPLLTTAAN TLTPISTGTD
460 470 480 490 500
SVLQDMSLAS AAVEQIKSSL FIYPSNMQTV LLSAQVDLPS QTDQQNLGDI
510 520 530 540 550
FQNQWGLSFI NEPSAGPETV IGKSSDHKVM EVTFQGEYPA TLVSQGAEII
560 570 580 590 600
PSGTEHPVFP KAYELEKRTS PQVLGHILKP GTTESGALSL DPSHIGDLQK
610 620 630 640 650
ADTSSQGALV FLSKDYEIEN QNPLASPTNT LLGSAKEQRY QRGLERNDSW
660 670 680 690
GSFDLRAAIV YHTKEMESIW NLQKQDPKRI ITYNEAMDSP DQ
Length:692
Mass (Da):75,657
Last modified:March 15, 2005 - v1
Checksum:i3E295AC111814564
GO
Isoform 2 (identifier: Q5F2E7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     676-692: DPKRIITYNEAMDSPDQ → VFCLCVYMYTYVHHVMSLHGRERTLDPLELALHWS

Note: No experimental confirmation available.
Show »
Length:710
Mass (Da):77,885
Checksum:i3123F4711F98E38B
GO

Sequence cautioni

The sequence BAC65776 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti52Missing in BAE42015 (PubMed:16141072).Curated1
Sequence conflicti57Q → R in BAE42015 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019729676 – 692DPKRI…DSPDQ → VFCLCVYMYTYVHHVMSLHG RERTLDPLELALHWS in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122494 mRNA. Translation: BAC65776.1. Different initiation.
AK132603 mRNA. Translation: BAE21256.1.
AK152336 mRNA. Translation: BAE31134.1.
AK160601 mRNA. Translation: BAE35905.1.
AK170764 mRNA. Translation: BAE42015.1.
AL591136 Genomic DNA. Translation: CAI51880.1.
CCDSiCCDS25083.1. [Q5F2E7-1]
RefSeqiNP_001019376.1. NM_001024205.2. [Q5F2E7-1]
XP_006534125.1. XM_006534062.3. [Q5F2E7-1]
UniGeneiMm.428996.

Genome annotation databases

EnsembliENSMUST00000100802; ENSMUSP00000098365; ENSMUSG00000037857. [Q5F2E7-1]
ENSMUST00000181023; ENSMUSP00000137922; ENSMUSG00000037857. [Q5F2E7-2]
GeneIDi68564.
KEGGimmu:68564.
UCSCiuc007khd.2. mouse. [Q5F2E7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122494 mRNA. Translation: BAC65776.1. Different initiation.
AK132603 mRNA. Translation: BAE21256.1.
AK152336 mRNA. Translation: BAE31134.1.
AK160601 mRNA. Translation: BAE35905.1.
AK170764 mRNA. Translation: BAE42015.1.
AL591136 Genomic DNA. Translation: CAI51880.1.
CCDSiCCDS25083.1. [Q5F2E7-1]
RefSeqiNP_001019376.1. NM_001024205.2. [Q5F2E7-1]
XP_006534125.1. XM_006534062.3. [Q5F2E7-1]
UniGeneiMm.428996.

3D structure databases

ProteinModelPortaliQ5F2E7.
SMRiQ5F2E7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi212929. 3 interactors.
IntActiQ5F2E7. 1 interactor.
STRINGi10090.ENSMUSP00000098365.

PTM databases

iPTMnetiQ5F2E7.
PhosphoSitePlusiQ5F2E7.

Proteomic databases

EPDiQ5F2E7.
PaxDbiQ5F2E7.
PeptideAtlasiQ5F2E7.
PRIDEiQ5F2E7.

Protocols and materials databases

DNASUi68564.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000100802; ENSMUSP00000098365; ENSMUSG00000037857. [Q5F2E7-1]
ENSMUST00000181023; ENSMUSP00000137922; ENSMUSG00000037857. [Q5F2E7-2]
GeneIDi68564.
KEGGimmu:68564.
UCSCiuc007khd.2. mouse. [Q5F2E7-1]

Organism-specific databases

CTDi57532.
MGIiMGI:1915814. Nufip2.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IGEW. Eukaryota.
ENOG41102P5. LUCA.
GeneTreeiENSGT00440000038328.
HOGENOMiHOG000220869.
HOVERGENiHBG065794.
InParanoidiQ5F2E7.
OMAiEMESVWN.
OrthoDBiEOG091G040J.
PhylomeDBiQ5F2E7.
TreeFamiTF332832.

Miscellaneous databases

PROiQ5F2E7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000037857.
GenevisibleiQ5F2E7. MM.

Family and domain databases

InterProiIPR032747. NUFIP2.
[Graphical view]
PANTHERiPTHR28333. PTHR28333. 1 hit.
PfamiPF15293. NUFIP2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNUFP2_MOUSE
AccessioniPrimary (citable) accession number: Q5F2E7
Secondary accession number(s): Q3TCE2, Q3V195, Q80TF1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: March 15, 2005
Last modified: November 30, 2016
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.