Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5F2E7 (NUFP2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 71. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Nuclear fragile X mental retardation-interacting protein 2
Alternative name(s):
82 kDa FMRP-interacting protein
Short name=82-FIP
FMRP-interacting protein 2
Gene names
Name:Nufip2
Synonyms:Kiaa1321
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length692 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Binds RNA By similarity.

Subunit structure

Interacts with FMRP By similarity.

Subcellular location

Nucleus. Cytoplasm. Note: Localized in both nucleus and cytoplasm in most neurons. In the cortex, distributed in a diffuse way in the nucleus and in the cytoplasm. Localized in the cytoplasm in neurons of the dentate gyrus in the olfactive bulb, in the ependymal epithelium and in the granular layer of the cerebellum. In Purkinje cells, distributed in both cell compartments and in nuclear dots adjacent to the nucleolus. Ref.4

Sequence caution

The sequence BAC65776.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5F2E7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5F2E7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     676-692: DPKRIITYNEAMDSPDQ → VFCLCVYMYTYVHHVMSLHGRERTLDPLELALHWS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 692692Nuclear fragile X mental retardation-interacting protein 2
PRO_0000245522

Regions

Compositional bias12 – 6150His-rich
Compositional bias373 – 41442Ser-rich

Amino acid modifications

Modified residue881Phosphothreonine By similarity
Modified residue1131Phosphoserine By similarity
Modified residue1141Phosphoserine By similarity
Modified residue2131Phosphoserine Ref.7
Modified residue2151Phosphoserine Ref.7
Modified residue2191Phosphotyrosine By similarity
Modified residue2201Phosphothreonine By similarity
Modified residue2211Phosphothreonine By similarity
Modified residue3761Phosphoserine By similarity
Modified residue5691Phosphothreonine By similarity
Modified residue5701Phosphoserine By similarity
Modified residue6261Phosphoserine By similarity
Modified residue6301Phosphothreonine By similarity
Modified residue6341Phosphoserine By similarity
Modified residue6491Phosphoserine Ref.7 Ref.8 Ref.9
Modified residue6521Phosphoserine By similarity
Modified residue6891Phosphoserine By similarity

Natural variations

Alternative sequence676 – 69217DPKRI…DSPDQ → VFCLCVYMYTYVHHVMSLHG RERTLDPLELALHWS in isoform 2.
VSP_019729

Experimental info

Sequence conflict521Missing in BAE42015. Ref.2
Sequence conflict571Q → R in BAE42015. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 15, 2005. Version 1.
Checksum: 3E295AC111814564

FASTA69275,657
        10         20         30         40         50         60 
MEEKPGQPQP QHHHSHHHPH HHPQQQQQQQ SHHHHHYYFY NHSHNHHHHH HHQQPHQYLQ 

        70         80         90        100        110        120 
HGAEGSPKAQ PKPLKHEQKH TLQQHQETPK KKTGYGEING NAGEREISLK SLSSDEATNP 

       130        140        150        160        170        180 
ISRVLNGNQQ VVETSLKQTV KTSTFGKAGI KTKNFIQKNS MDKKNGKSYE NKSGETQAVD 

       190        200        210        220        230        240 
KTDTIAIPNG VITSSSGYIT NGYMSKGADN DGSGSESGYT TPKKRKARRN SAKGCENLNL 

       250        260        270        280        290        300 
VQDKIMQETS VPALKQGLET LKPDYSEQKG MRVDGSKPIW KYETGPGGTS RGKPAMGDVL 

       310        320        330        340        350        360 
RKSSDIKPGL SSKKFDDRPK GKHASAAASK EDSWTLFKPP PVFPVDNSSA KIVPKISYAS 

       370        380        390        400        410        420 
KVKENLNKTV QNSSVSPSSS SSSSSTGETQ TQSSSRLSQV PMSALKSVTS ASFSNGPVLA 

       430        440        450        460        470        480 
GTDGSVYPSG GQPLLTTAAN TLTPISTGTD SVLQDMSLAS AAVEQIKSSL FIYPSNMQTV 

       490        500        510        520        530        540 
LLSAQVDLPS QTDQQNLGDI FQNQWGLSFI NEPSAGPETV IGKSSDHKVM EVTFQGEYPA 

       550        560        570        580        590        600 
TLVSQGAEII PSGTEHPVFP KAYELEKRTS PQVLGHILKP GTTESGALSL DPSHIGDLQK 

       610        620        630        640        650        660 
ADTSSQGALV FLSKDYEIEN QNPLASPTNT LLGSAKEQRY QRGLERNDSW GSFDLRAAIV 

       670        680        690 
YHTKEMESIW NLQKQDPKRI ITYNEAMDSP DQ 

« Hide

Isoform 2 [UniParc].

Checksum: 3123F4711F98E38B
Show »

FASTA71077,885

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: C57BL/6J and NOD.
Tissue: Bone marrow, Dendritic cell, Embryo and Head.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"82-FIP, a novel FMRP (fragile X mental retardation protein) interacting protein, shows a cell cycle-dependent intracellular localization."
Bardoni B., Castets M., Huot M.-E., Schenck A., Adinolfi S., Corbin F., Pastore A., Khandjian E.W., Mandel J.-L.
Hum. Mol. Genet. 12:1689-1698(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
[5]"Phosphoproteomic analysis of the developing mouse brain."
Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P.
Mol. Cell. Proteomics 3:1093-1101(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic brain.
[6]"Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations."
Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M.
Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain cortex.
[7]"Large-scale phosphorylation analysis of mouse liver."
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-213; SER-215 AND SER-649, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
[8]"The phagosomal proteome in interferon-gamma-activated macrophages."
Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-649, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[9]"Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-649, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic fibroblast.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK122494 mRNA. Translation: BAC65776.1. Different initiation.
AK132603 mRNA. Translation: BAE21256.1.
AK152336 mRNA. Translation: BAE31134.1.
AK160601 mRNA. Translation: BAE35905.1.
AK170764 mRNA. Translation: BAE42015.1.
AL591136 Genomic DNA. Translation: CAI51880.1.
RefSeqNP_001019376.1. NM_001024205.2.
XP_006534125.1. XM_006534062.1.
UniGeneMm.428996.

3D structure databases

ProteinModelPortalQ5F2E7.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid212929. 1 interaction.
STRING10090.ENSMUSP00000049412.

PTM databases

PhosphoSiteQ5F2E7.

Proteomic databases

PaxDbQ5F2E7.
PRIDEQ5F2E7.

Protocols and materials databases

DNASU68564.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000100802; ENSMUSP00000098365; ENSMUSG00000037857. [Q5F2E7-1]
ENSMUST00000181023; ENSMUSP00000137922; ENSMUSG00000037857. [Q5F2E7-2]
GeneID68564.
KEGGmmu:68564.
UCSCuc007khd.2. mouse. [Q5F2E7-1]

Organism-specific databases

CTD57532.
MGIMGI:1915814. Nufip2.
RougeSearch...

Phylogenomic databases

eggNOGopiNOG06224.
GeneTreeENSGT00440000038328.
HOGENOMHOG000220869.
HOVERGENHBG065794.
OMAKEMESVW.
OrthoDBEOG71RXJ4.
PhylomeDBQ5F2E7.
TreeFamTF332832.

Gene expression databases

BgeeQ5F2E7.
GenevestigatorQ5F2E7.

Family and domain databases

ProtoNetSearch...

Other

NextBio327462.
PROQ5F2E7.
SOURCESearch...

Entry information

Entry nameNUFP2_MOUSE
AccessionPrimary (citable) accession number: Q5F2E7
Secondary accession number(s): Q3TCE2, Q3V195, Q80TF1
Entry history
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: March 15, 2005
Last modified: April 16, 2014
This is version 71 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot