Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PDZ domain-containing protein 11

Gene

PDZD11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • protein C-terminus binding Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-196780 Biotin transport and metabolism
R-HSA-199220 Vitamin B5 (pantothenate) metabolism
R-HSA-425397 Transport of vitamins, nucleosides, and related molecules
R-HSA-6803544 Ion influx/efflux at host-pathogen interface
R-HSA-936837 Ion transport by P-type ATPases

Names & Taxonomyi

Protein namesi
Recommended name:
PDZ domain-containing protein 11
Alternative name(s):
ATPase-interacting PDZ protein
Plasma membrane calcium ATPase-interacting single-PDZ protein
Short name:
PMCA-interacting single-PDZ protein
Gene namesi
Name:PDZD11
Synonyms:AIPP1, PDZK11, PISP
ORF Names:HSPC227, UNQ6486/PRO21335
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000120509.10
HGNCiHGNC:28034 PDZD11
MIMi300632 gene
neXtProtiNX_Q5EBL8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Secreted

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000120509
PharmGKBiPA134968632

Polymorphism and mutation databases

BioMutaiPDZD11
DMDMi73621365

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000582731 – 140PDZ domain-containing protein 11Add BLAST140

Proteomic databases

EPDiQ5EBL8
MaxQBiQ5EBL8
PaxDbiQ5EBL8
PeptideAtlasiQ5EBL8
PRIDEiQ5EBL8

PTM databases

iPTMnetiQ5EBL8
PhosphoSitePlusiQ5EBL8

Expressioni

Tissue specificityi

Widely expressed (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000120509
CleanExiHS_PDZD11
GenevisibleiQ5EBL8 HS

Organism-specific databases

HPAiHPA003972

Interactioni

Subunit structurei

Interacts with ATP2B1, ATP2B2, ATP2B3, ATP2B4 and ATP7A.2 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • protein C-terminus binding Source: UniProtKB

Protein-protein interaction databases

BioGridi119405, 16 interactors
CORUMiQ5EBL8
IntActiQ5EBL8, 14 interactors
MINTiQ5EBL8
STRINGi9606.ENSP00000239666

Structurei

3D structure databases

ProteinModelPortaliQ5EBL8
SMRiQ5EBL8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini47 – 129PDZPROSITE-ProRule annotationAdd BLAST83

Phylogenomic databases

eggNOGiENOG410ITA4 Eukaryota
ENOG4111GHP LUCA
GeneTreeiENSGT00530000063178
HOGENOMiHOG000015753
HOVERGENiHBG059761
InParanoidiQ5EBL8
OMAiFPYNYQR
OrthoDBiEOG091G11VM
PhylomeDBiQ5EBL8
TreeFamiTF318964

Family and domain databases

InterProiView protein in InterPro
IPR001478 PDZ
IPR036034 PDZ_sf
PfamiView protein in Pfam
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50106 PDZ, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5EBL8-1) [UniParc]FASTAAdd to basket
Also known as: AIPP1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSRIPYDDY PVVFLPAYEN PPAWIPPHER VHHPDYNNEL TQFLPRTITL
60 70 80 90 100
KKPPGAQLGF NIRGGKASQL GIFISKVIPD SDAHRAGLQE GDQVLAVNDV
110 120 130 140
DFQDIEHSKA VEILKTAREI SMRVRFFPYN YHRQKERTVH
Length:140
Mass (Da):16,131
Last modified:August 16, 2005 - v2
Checksum:i601216B821A36DCE
GO
Isoform 2 (identifier: Q5EBL8-2) [UniParc]FASTAAdd to basket
Also known as: AIPP1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGWSCCLKLAGLLSLLNHFLSVLIHSSRALPE

Note: No experimental confirmation available.
Show »
Length:171
Mass (Da):19,492
Checksum:iE17B82B685BD28F8
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06942281S → Y1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0150771M → MGWSCCLKLAGLLSLLNHFL SVLIHSSRALPE in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151061 mRNA Translation: AAF36147.1
AY358829 mRNA Translation: AAQ89188.1
AK024746 mRNA No translation available.
CR457149 mRNA Translation: CAG33430.1
BX537725 mRNA Translation: CAD97820.1
AL357752 Genomic DNA No translation available.
CH471132 Genomic DNA Translation: EAX05345.1
CH471132 Genomic DNA Translation: EAX05346.1
BC012996 mRNA Translation: AAH12996.1
BC089433 mRNA Translation: AAH89433.1
CCDSiCCDS14400.1 [Q5EBL8-1]
RefSeqiNP_057568.1, NM_016484.4 [Q5EBL8-1]
XP_011529275.1, XM_011530973.2 [Q5EBL8-1]
XP_016885057.1, XM_017029568.1
UniGeneiHs.11042

Genome annotation databases

EnsembliENST00000239666; ENSP00000239666; ENSG00000120509 [Q5EBL8-1]
ENST00000374454; ENSP00000363578; ENSG00000120509 [Q5EBL8-1]
GeneIDi51248
KEGGihsa:51248
UCSCiuc004dyd.2 human [Q5EBL8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiPDZ11_HUMAN
AccessioniPrimary (citable) accession number: Q5EBL8
Secondary accession number(s): D3DVU3, Q6UWE1, Q9P0Q1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: August 16, 2005
Last modified: May 23, 2018
This is version 127 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health