Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PDZ domain-containing protein 11

Gene

PDZD11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • protein C-terminus binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-196780. Biotin transport and metabolism.
R-HSA-199220. Vitamin B5 (pantothenate) metabolism.
R-HSA-425397. Transport of vitamins, nucleosides, and related molecules.
R-HSA-936837. Ion transport by P-type ATPases.

Names & Taxonomyi

Protein namesi
Recommended name:
PDZ domain-containing protein 11
Alternative name(s):
ATPase-interacting PDZ protein
Plasma membrane calcium ATPase-interacting single-PDZ protein
Short name:
PMCA-interacting single-PDZ protein
Gene namesi
Name:PDZD11
Synonyms:AIPP1, PDZK11, PISP
ORF Names:HSPC227, UNQ6486/PRO21335
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:28034. PDZD11.

Subcellular locationi

Isoform 1 :
  • Cytoplasm 1 Publication

GO - Cellular componenti

  • basolateral plasma membrane Source: UniProtKB
  • cell-cell junction Source: GO_Central
  • cytosol Source: UniProtKB
  • extracellular region Source: UniProtKB-SubCell
  • presynapse Source: GOC
  • synapse Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134968632.

Polymorphism and mutation databases

BioMutaiPDZD11.
DMDMi73621365.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 140140PDZ domain-containing protein 11PRO_0000058273Add
BLAST

Proteomic databases

EPDiQ5EBL8.
MaxQBiQ5EBL8.
PaxDbiQ5EBL8.
PRIDEiQ5EBL8.

PTM databases

iPTMnetiQ5EBL8.
PhosphoSiteiQ5EBL8.

Expressioni

Tissue specificityi

Widely expressed (at protein level).1 Publication

Gene expression databases

BgeeiQ5EBL8.
CleanExiHS_PDZD11.
GenevisibleiQ5EBL8. HS.

Organism-specific databases

HPAiHPA003972.

Interactioni

Subunit structurei

Interacts with ATP2B1, ATP2B2, ATP2B3, ATP2B4 and ATP7A.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ATP7AQ046564EBI-1644207,EBI-7706409
PLEKHA5Q9HAU03EBI-1644207,EBI-945934

GO - Molecular functioni

  • protein C-terminus binding Source: UniProtKB

Protein-protein interaction databases

BioGridi119405. 13 interactions.
IntActiQ5EBL8. 11 interactions.
MINTiMINT-1352448.
STRINGi9606.ENSP00000239666.

Structurei

3D structure databases

ProteinModelPortaliQ5EBL8.
SMRiQ5EBL8. Positions 37-127.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini47 – 12983PDZPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410ITA4. Eukaryota.
ENOG4111GHP. LUCA.
GeneTreeiENSGT00550000074582.
HOGENOMiHOG000015753.
HOVERGENiHBG059761.
InParanoidiQ5EBL8.
OMAiDDYQLPV.
OrthoDBiEOG7SV0X0.
PhylomeDBiQ5EBL8.
TreeFamiTF318964.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5EBL8-1) [UniParc]FASTAAdd to basket

Also known as: AIPP1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSRIPYDDY PVVFLPAYEN PPAWIPPHER VHHPDYNNEL TQFLPRTITL
60 70 80 90 100
KKPPGAQLGF NIRGGKASQL GIFISKVIPD SDAHRAGLQE GDQVLAVNDV
110 120 130 140
DFQDIEHSKA VEILKTAREI SMRVRFFPYN YHRQKERTVH
Length:140
Mass (Da):16,131
Last modified:August 16, 2005 - v2
Checksum:i601216B821A36DCE
GO
Isoform 2 (identifier: Q5EBL8-2) [UniParc]FASTAAdd to basket

Also known as: AIPP1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGWSCCLKLAGLLSLLNHFLSVLIHSSRALPE

Note: No experimental confirmation available.
Show »
Length:171
Mass (Da):19,492
Checksum:iE17B82B685BD28F8
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti81 – 811S → Y.1 Publication
VAR_069422

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MGWSCCLKLAGLLSLLNHFL SVLIHSSRALPE in isoform 2. 1 PublicationVSP_015077

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151061 mRNA. Translation: AAF36147.1.
AY358829 mRNA. Translation: AAQ89188.1.
AK024746 mRNA. No translation available.
CR457149 mRNA. Translation: CAG33430.1.
BX537725 mRNA. Translation: CAD97820.1.
AL357752 Genomic DNA. Translation: CAI41488.1.
CH471132 Genomic DNA. Translation: EAX05345.1.
CH471132 Genomic DNA. Translation: EAX05346.1.
BC012996 mRNA. Translation: AAH12996.1.
BC089433 mRNA. Translation: AAH89433.1.
CCDSiCCDS14400.1. [Q5EBL8-1]
RefSeqiNP_057568.1. NM_016484.4. [Q5EBL8-1]
XP_011529275.1. XM_011530973.1. [Q5EBL8-1]
UniGeneiHs.11042.

Genome annotation databases

EnsembliENST00000239666; ENSP00000239666; ENSG00000120509. [Q5EBL8-1]
ENST00000374454; ENSP00000363578; ENSG00000120509. [Q5EBL8-1]
GeneIDi51248.
KEGGihsa:51248.
UCSCiuc004dyd.2. human. [Q5EBL8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151061 mRNA. Translation: AAF36147.1.
AY358829 mRNA. Translation: AAQ89188.1.
AK024746 mRNA. No translation available.
CR457149 mRNA. Translation: CAG33430.1.
BX537725 mRNA. Translation: CAD97820.1.
AL357752 Genomic DNA. Translation: CAI41488.1.
CH471132 Genomic DNA. Translation: EAX05345.1.
CH471132 Genomic DNA. Translation: EAX05346.1.
BC012996 mRNA. Translation: AAH12996.1.
BC089433 mRNA. Translation: AAH89433.1.
CCDSiCCDS14400.1. [Q5EBL8-1]
RefSeqiNP_057568.1. NM_016484.4. [Q5EBL8-1]
XP_011529275.1. XM_011530973.1. [Q5EBL8-1]
UniGeneiHs.11042.

3D structure databases

ProteinModelPortaliQ5EBL8.
SMRiQ5EBL8. Positions 37-127.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119405. 13 interactions.
IntActiQ5EBL8. 11 interactions.
MINTiMINT-1352448.
STRINGi9606.ENSP00000239666.

PTM databases

iPTMnetiQ5EBL8.
PhosphoSiteiQ5EBL8.

Polymorphism and mutation databases

BioMutaiPDZD11.
DMDMi73621365.

Proteomic databases

EPDiQ5EBL8.
MaxQBiQ5EBL8.
PaxDbiQ5EBL8.
PRIDEiQ5EBL8.

Protocols and materials databases

DNASUi51248.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000239666; ENSP00000239666; ENSG00000120509. [Q5EBL8-1]
ENST00000374454; ENSP00000363578; ENSG00000120509. [Q5EBL8-1]
GeneIDi51248.
KEGGihsa:51248.
UCSCiuc004dyd.2. human. [Q5EBL8-1]

Organism-specific databases

CTDi51248.
GeneCardsiPDZD11.
HGNCiHGNC:28034. PDZD11.
HPAiHPA003972.
MIMi300632. gene.
neXtProtiNX_Q5EBL8.
PharmGKBiPA134968632.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410ITA4. Eukaryota.
ENOG4111GHP. LUCA.
GeneTreeiENSGT00550000074582.
HOGENOMiHOG000015753.
HOVERGENiHBG059761.
InParanoidiQ5EBL8.
OMAiDDYQLPV.
OrthoDBiEOG7SV0X0.
PhylomeDBiQ5EBL8.
TreeFamiTF318964.

Enzyme and pathway databases

ReactomeiR-HSA-196780. Biotin transport and metabolism.
R-HSA-199220. Vitamin B5 (pantothenate) metabolism.
R-HSA-425397. Transport of vitamins, nucleosides, and related molecules.
R-HSA-936837. Ion transport by P-type ATPases.

Miscellaneous databases

GeneWikiiPDZD11.
GenomeRNAii51248.
PROiQ5EBL8.
SOURCEiSearch...

Gene expression databases

BgeeiQ5EBL8.
CleanExiHS_PDZD11.
GenevisibleiQ5EBL8. HS.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Umbilical cord blood.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Artery smooth muscle.
  4. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Cerebellum.
  6. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Chondrosarcoma and Muscle.
  9. "Characterization of PISP, a novel single-PDZ protein that binds to all plasma membrane Ca2+-ATPase b-splice variants."
    Goellner G.M., DeMarco S.J., Strehler E.E.
    Ann. N. Y. Acad. Sci. 986:461-471(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ATP2B1; ATP2B2; ATP2B3 AND ATP2B4, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  10. "A single PDZ domain protein interacts with the Menkes copper ATPase, ATP7A. A new protein implicated in copper homeostasis."
    Stephenson S.E., Dubach D., Lim C.M., Mercer J.F., La Fontaine S.
    J. Biol. Chem. 280:33270-33279(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ATP7A, IDENTIFICATION OF ALTERNATIVE SPLICING (ISOFORMS 1 AND 2).
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. Cited for: VARIANT TYR-81.

Entry informationi

Entry nameiPDZ11_HUMAN
AccessioniPrimary (citable) accession number: Q5EBL8
Secondary accession number(s): D3DVU3, Q6UWE1, Q9P0Q1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: August 16, 2005
Last modified: June 8, 2016
This is version 111 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.