Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5BJH7 (YIF1B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 69. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein YIF1B
Alternative name(s):
YIP1-interacting factor homolog B
Gene names
Name:YIF1B
ORF Names:PP4519, UNQ3073/PRO9905
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length314 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Sequence similarities

Belongs to the YIF1 family.

Ontologies

Keywords
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   PTMAcetylation
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5BJH7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5BJH7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.
Isoform 3 (identifier: Q5BJH7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.
Isoform 4 (identifier: Q5BJH7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.
     264-294: IRTLRLKILADAAAEGVPVRGARNQLRMYLT → FPLLPGAVAHACNPSTLGGRGGRITRSGRCG
     295-314: Missing.
Isoform 5 (identifier: Q5BJH7-5)

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.
     264-297: IRTLRLKILADAAAEGVPVRGARNQLRMYLTMAV → FPLLPGAVAHACNPSTLGGRGGRITRSGDQDHPG
     298-314: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: Q5BJH7-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MHPAGLAAAAAGTPRLRKWP → MPGSA
Note: Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 314314Protein YIF1B
PRO_0000307258

Regions

Topological domain1 – 156156Cytoplasmic Potential
Transmembrane157 – 17721Helical; Potential
Topological domain178 – 19215Extracellular Potential
Transmembrane193 – 21321Helical; Potential
Topological domain214 – 2196Cytoplasmic Potential
Transmembrane220 – 24021Helical; Potential
Topological domain2411Extracellular Potential
Transmembrane242 – 26221Helical; Potential
Topological domain263 – 29230Cytoplasmic Potential
Transmembrane293 – 31321Helical; Potential
Topological domain3141Extracellular Potential

Amino acid modifications

Modified residue11N-acetylmethionine By similarity
Modified residue131Phosphothreonine By similarity
Modified residue651Phosphoserine Ref.7 Ref.8

Natural variations

Alternative sequence1 – 3131Missing in isoform 2.
VSP_028650
Alternative sequence1 – 2020MHPAG…LRKWP → MPGSA in isoform 6.
VSP_046823
Alternative sequence17 – 193Missing in isoform 3, isoform 4 and isoform 5.
VSP_028651
Alternative sequence264 – 29734IRTLR…LTMAV → FPLLPGAVAHACNPSTLGGR GGRITRSGDQDHPG in isoform 5.
VSP_028652
Alternative sequence264 – 29431IRTLR…RMYLT → FPLLPGAVAHACNPSTLGGR GGRITRSGRCG in isoform 4.
VSP_028653
Alternative sequence295 – 31420Missing in isoform 4.
VSP_028654
Alternative sequence298 – 31417Missing in isoform 5.
VSP_028655
Natural variant561P → S.
Corresponds to variant rs11556992 [ dbSNP | Ensembl ].
VAR_035385

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 27, 2005. Version 1.
Checksum: 93A2521A3332D3AD

FASTA31434,435
        10         20         30         40         50         60 
MHPAGLAAAA AGTPRLRKWP SKRRIPVSQP GMADPHQLFD DTSSAQSRGY GAQRAPGGLS 

        70         80         90        100        110        120 
YPAASPTPHA AFLADPVSNM AMAYGSSLAA QGKELVDKNI DRFIPITKLK YYFAVDTMYV 

       130        140        150        160        170        180 
GRKLGLLFFP YLHQDWEVQY QQDTPVAPRF DVNAPDLYIP AMAFITYVLV AGLALGTQDR 

       190        200        210        220        230        240 
FSPDLLGLQA SSALAWLTLE VLAILLSLYL VTVNTDLTTI DLVAFLGYKY VGMIGGVLMG 

       250        260        270        280        290        300 
LLFGKIGYYL VLGWCCVAIF VFMIRTLRLK ILADAAAEGV PVRGARNQLR MYLTMAVAAA 

       310 
QPMLMYWLTF HLVR 

« Hide

Isoform 2 [UniParc].

Checksum: F68245FE42608C59
Show »

FASTA28331,175
Isoform 3 [UniParc].

Checksum: 006B7C3F190E281E
Show »

FASTA31133,965
Isoform 4 [UniParc].

Checksum: 76319390816EF13F
Show »

FASTA29131,245
Isoform 5 [UniParc].

Checksum: 3ADFF564F9ED3081
Show »

FASTA29431,579
Isoform 6 [UniParc].

Checksum: D2B3DA4653839855
Show »

FASTA29932,825

References

[1]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[2]"Large-scale cDNA transfection screening for genes related to cancer development and progression."
Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. expand/collapse author list , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Lymph node.
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-314 (ISOFORM 3).
Tissue: Colon, Lung and Placenta.
[7]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[9]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY358965 mRNA. Translation: AAQ89324.1.
AF258578 mRNA. Translation: AAG23781.1.
AL833382 mRNA. Translation: CAI46138.1.
AC011479 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW56772.1.
BC007644 mRNA. Translation: AAH07644.1.
BC014974 mRNA. Translation: AAH14974.1.
BC091477 mRNA. Translation: AAH91477.2.
RefSeqNP_001034760.1. NM_001039671.2.
NP_001034761.1. NM_001039672.2.
NP_001034762.1. NM_001039673.2.
NP_001138933.1. NM_001145461.1.
NP_001138934.1. NM_001145462.1.
NP_001138935.1. NM_001145463.1.
NP_291035.1. NM_033557.3.
XP_005259441.1. XM_005259384.2.
XP_005259442.1. XM_005259385.1.
UniGeneHs.280741.

3D structure databases

ProteinModelPortalQ5BJH7.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124728. 2 interactions.
STRING9606.ENSP00000343435.

PTM databases

PhosphoSiteQ5BJH7.

Polymorphism databases

DMDM121944384.

Proteomic databases

PaxDbQ5BJH7.
PRIDEQ5BJH7.

Protocols and materials databases

DNASU90522.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000329420; ENSP00000329559; ENSG00000167645. [Q5BJH7-6]
ENST00000337679; ENSP00000337411; ENSG00000167645. [Q5BJH7-4]
ENST00000339413; ENSP00000343435; ENSG00000167645. [Q5BJH7-1]
ENST00000392124; ENSP00000375971; ENSG00000167645. [Q5BJH7-2]
ENST00000591755; ENSP00000465446; ENSG00000167645. [Q5BJH7-5]
ENST00000591784; ENSP00000465230; ENSG00000167645. [Q5BJH7-2]
ENST00000592694; ENSP00000466428; ENSG00000167645. [Q5BJH7-2]
GeneID90522.
KEGGhsa:90522.
UCSCuc002ohw.2. human. [Q5BJH7-1]
uc002ohy.2. human. [Q5BJH7-3]
uc002oia.2. human. [Q5BJH7-4]
uc002oib.3. human. [Q5BJH7-5]

Organism-specific databases

CTD90522.
GeneCardsGC19M038794.
HGNCHGNC:30511. YIF1B.
HPAHPA055257.
neXtProtNX_Q5BJH7.
PharmGKBPA142670561.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5197.
HOGENOMHOG000234333.
HOVERGENHBG053252.
InParanoidQ5BJH7.
OMAPMSNLAM.
OrthoDBEOG7SXW3T.
PhylomeDBQ5BJH7.
TreeFamTF314528.

Gene expression databases

ArrayExpressQ5BJH7.
BgeeQ5BJH7.
CleanExHS_YIF1B.
GenevestigatorQ5BJH7.

Family and domain databases

InterProIPR005578. Hrf1.
[Graphical view]
PANTHERPTHR14083. PTHR14083. 1 hit.
PfamPF03878. YIF1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi90522.
NextBio76803.
PROQ5BJH7.

Entry information

Entry nameYIF1B_HUMAN
AccessionPrimary (citable) accession number: Q5BJH7
Secondary accession number(s): H7BXS8 expand/collapse secondary AC list , Q5JPC2, Q8WY70, Q96C02, Q96IC4
Entry history
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: September 27, 2005
Last modified: April 16, 2014
This is version 69 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM