Q5BJH7 (YIF1B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 60.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein YIF1B Alternative name(s): YIP1-interacting factor homolog B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 314 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | Belongs to the YIF1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5BJH7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5BJH7-2) The sequence of this isoform differs from the canonical sequence as follows: 1-31: Missing. | ||||||
| Isoform 3 (identifier: Q5BJH7-3) The sequence of this isoform differs from the canonical sequence as follows: 17-19: Missing. | ||||||
| Isoform 4 (identifier: Q5BJH7-4) The sequence of this isoform differs from the canonical sequence as follows: 17-19: Missing. 264-294: IRTLRLKILADAAAEGVPVRGARNQLRMYLT → FPLLPGAVAHACNPSTLGGRGGRITRSGRCG 295-314: Missing. | ||||||
| Isoform 5 (identifier: Q5BJH7-5) The sequence of this isoform differs from the canonical sequence as follows: 17-19: Missing. 264-297: IRTLRLKILADAAAEGVPVRGARNQLRMYLTMAV → FPLLPGAVAHACNPSTLGGRGGRITRSGDQDHPG 298-314: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 314 | 314 | Protein YIF1B | PRO_0000307258 | |||||
Regions | |||||||||
| Topological domain | 1 – 156 | 156 | Cytoplasmic Potential | ||||||
| Transmembrane | 157 – 177 | 21 | Helical; Potential | ||||||
| Topological domain | 178 – 192 | 15 | Extracellular Potential | ||||||
| Transmembrane | 193 – 213 | 21 | Helical; Potential | ||||||
| Topological domain | 214 – 219 | 6 | Cytoplasmic Potential | ||||||
| Transmembrane | 220 – 240 | 21 | Helical; Potential | ||||||
| Topological domain | 241 | 1 | Extracellular Potential | ||||||
| Transmembrane | 242 – 262 | 21 | Helical; Potential | ||||||
| Topological domain | 263 – 292 | 30 | Cytoplasmic Potential | ||||||
| Transmembrane | 293 – 313 | 21 | Helical; Potential | ||||||
| Topological domain | 314 | 1 | Extracellular Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 65 | 1 | Phosphoserine Ref.6 Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 31 | 31 | Missing in isoform 2. | VSP_028650 | |||||
| Alternative sequence | 17 – 19 | 3 | Missing in isoform 3, isoform 4 and isoform 5. | VSP_028651 | |||||
| Alternative sequence | 264 – 297 | 34 | IRTLR…LTMAV → FPLLPGAVAHACNPSTLGGR GGRITRSGDQDHPG in isoform 5. | VSP_028652 | |||||
| Alternative sequence | 264 – 294 | 31 | IRTLR…RMYLT → FPLLPGAVAHACNPSTLGGR GGRITRSGRCG in isoform 4. | VSP_028653 | |||||
| Alternative sequence | 295 – 314 | 20 | Missing in isoform 4. | VSP_028654 | |||||
| Alternative sequence | 298 – 314 | 17 | Missing in isoform 5. | VSP_028655 | |||||
| Natural variant | 56 | 1 | P → S. Corresponds to variant rs11556992 [ dbSNP | Ensembl ]. | VAR_035385 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [2] | "Large-scale cDNA transfection screening for genes related to cancer development and progression." Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. Gu J.Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Lymph node. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-314 (ISOFORM 3). Tissue: Colon, Lung and Placenta. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [8] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY358965 mRNA. Translation: AAQ89324.1. AF258578 mRNA. Translation: AAG23781.1. AL833382 mRNA. Translation: CAI46138.1. CH471126 Genomic DNA. Translation: EAW56772.1. BC007644 mRNA. Translation: AAH07644.1. BC014974 mRNA. Translation: AAH14974.1. BC091477 mRNA. Translation: AAH91477.2. |
| IPI | IPI00060144. IPI00063544. IPI00395508. IPI00736813. IPI00869035. |
| RefSeq | NP_001034760.1. NM_001039671.2. NP_001034761.1. NM_001039672.2. NP_001034762.1. NM_001039673.2. NP_001138933.1. NM_001145461.1. NP_001138934.1. NM_001145462.1. NP_001138935.1. NM_001145463.1. NP_291035.1. NM_033557.3. |
| UniGene | Hs.280741. |
3D structure databases | |
| ProteinModelPortal | Q5BJH7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000343435. |
PTM databases | |
| PhosphoSite | Q5BJH7. |
Polymorphism databases | |
| DMDM | 121944384. |
Proteomic databases | |
| PaxDb | Q5BJH7. |
| PRIDE | Q5BJH7. |
Protocols and materials databases | |
| DNASU | 90522. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000337679; ENSP00000337411; ENSG00000167645. ENST00000339413; ENSP00000343435; ENSG00000167645. ENST00000392124; ENSP00000375971; ENSG00000167645. ENST00000591755; ENSP00000465446; ENSG00000167645. ENST00000591784; ENSP00000465230; ENSG00000167645. ENST00000592694; ENSP00000466428; ENSG00000167645. |
| GeneID | 90522. |
| KEGG | hsa:90522. |
| UCSC | uc002ohw.2. human. uc002ohy.2. human. uc002oia.2. human. uc002oib.3. human. |
Organism-specific databases | |
| CTD | 90522. |
| GeneCards | GC19M038794. |
| HGNC | HGNC:30511. YIF1B. |
| HPA | HPA055257. |
| neXtProt | NX_Q5BJH7. |
| PharmGKB | PA142670561. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5197. |
| HOGENOM | HOG000234333. |
| HOVERGEN | HBG053252. |
| InParanoid | Q5BJH7. |
| OMA | PMSNLAM. |
| OrthoDB | EOG40S0G5. |
Gene expression databases | |
| ArrayExpress | Q5BJH7. |
| Bgee | Q5BJH7. |
| CleanEx | HS_YIF1B. |
| Genevestigator | Q5BJH7. |
Family and domain databases | |
| InterPro | IPR005578. Hrf1. [Graphical view] |
| PANTHER | PTHR14083. PTHR14083. 1 hit. |
| Pfam | PF03878. YIF1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 90522. |
| NextBio | 76803. |
Entry information
| Entry name | YIF1B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5BJH7 Secondary accession number(s): Q5JPC2 Q96IC4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
