Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5BJH7

- YIF1B_HUMAN

UniProt

Q5BJH7 - YIF1B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein YIF1B

Gene

YIF1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein YIF1B
Alternative name(s):
YIP1-interacting factor homolog B
Gene namesi
Name:YIF1B
ORF Names:PP4519, UNQ3073/PRO9905
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:30511. YIF1B.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670561.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 314314Protein YIF1BPRO_0000307258Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei13 – 131PhosphothreonineBy similarity
Modified residuei65 – 651Phosphoserine2 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ5BJH7.
PaxDbiQ5BJH7.
PRIDEiQ5BJH7.

PTM databases

PhosphoSiteiQ5BJH7.

Expressioni

Gene expression databases

BgeeiQ5BJH7.
CleanExiHS_YIF1B.
ExpressionAtlasiQ5BJH7. baseline and differential.
GenevestigatoriQ5BJH7.

Organism-specific databases

HPAiHPA055257.

Interactioni

Protein-protein interaction databases

BioGridi124728. 4 interactions.
STRINGi9606.ENSP00000343435.

Structurei

3D structure databases

ProteinModelPortaliQ5BJH7.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 156156CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini178 – 19215ExtracellularSequence AnalysisAdd
BLAST
Topological domaini214 – 2196CytoplasmicSequence Analysis
Topological domaini241 – 2411ExtracellularSequence Analysis
Topological domaini263 – 29230CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini314 – 3141ExtracellularSequence Analysis

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei157 – 17721HelicalSequence AnalysisAdd
BLAST
Transmembranei193 – 21321HelicalSequence AnalysisAdd
BLAST
Transmembranei220 – 24021HelicalSequence AnalysisAdd
BLAST
Transmembranei242 – 26221HelicalSequence AnalysisAdd
BLAST
Transmembranei293 – 31321HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the YIF1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG5197.
GeneTreeiENSGT00390000009423.
HOGENOMiHOG000234333.
HOVERGENiHBG053252.
InParanoidiQ5BJH7.
OMAiPMSNLAM.
OrthoDBiEOG7SXW3T.
PhylomeDBiQ5BJH7.
TreeFamiTF314528.

Family and domain databases

InterProiIPR005578. Hrf1.
[Graphical view]
PANTHERiPTHR14083. PTHR14083. 1 hit.
PfamiPF03878. YIF1. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5BJH7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHPAGLAAAA AGTPRLRKWP SKRRIPVSQP GMADPHQLFD DTSSAQSRGY
60 70 80 90 100
GAQRAPGGLS YPAASPTPHA AFLADPVSNM AMAYGSSLAA QGKELVDKNI
110 120 130 140 150
DRFIPITKLK YYFAVDTMYV GRKLGLLFFP YLHQDWEVQY QQDTPVAPRF
160 170 180 190 200
DVNAPDLYIP AMAFITYVLV AGLALGTQDR FSPDLLGLQA SSALAWLTLE
210 220 230 240 250
VLAILLSLYL VTVNTDLTTI DLVAFLGYKY VGMIGGVLMG LLFGKIGYYL
260 270 280 290 300
VLGWCCVAIF VFMIRTLRLK ILADAAAEGV PVRGARNQLR MYLTMAVAAA
310
QPMLMYWLTF HLVR
Length:314
Mass (Da):34,435
Last modified:September 27, 2005 - v1
Checksum:i93A2521A3332D3AD
GO
Isoform 2 (identifier: Q5BJH7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.

Show »
Length:283
Mass (Da):31,175
Checksum:iF68245FE42608C59
GO
Isoform 3 (identifier: Q5BJH7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.

Show »
Length:311
Mass (Da):33,965
Checksum:i006B7C3F190E281E
GO
Isoform 4 (identifier: Q5BJH7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.
     264-294: IRTLRLKILADAAAEGVPVRGARNQLRMYLT → FPLLPGAVAHACNPSTLGGRGGRITRSGRCG
     295-314: Missing.

Show »
Length:291
Mass (Da):31,245
Checksum:i76319390816EF13F
GO
Isoform 5 (identifier: Q5BJH7-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.
     264-297: IRTLRLKILADAAAEGVPVRGARNQLRMYLTMAV → FPLLPGAVAHACNPSTLGGRGGRITRSGDQDHPG
     298-314: Missing.

Note: No experimental confirmation available.

Show »
Length:294
Mass (Da):31,579
Checksum:i3ADFF564F9ED3081
GO
Isoform 6 (identifier: Q5BJH7-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MHPAGLAAAAAGTPRLRKWP → MPGSA

Note: Gene prediction based on EST data.

Show »
Length:299
Mass (Da):32,825
Checksum:iD2B3DA4653839855
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti56 – 561P → S.
Corresponds to variant rs11556992 [ dbSNP | Ensembl ].
VAR_035385

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3131Missing in isoform 2. 2 PublicationsVSP_028650Add
BLAST
Alternative sequencei1 – 2020MHPAG…LRKWP → MPGSA in isoform 6. CuratedVSP_046823Add
BLAST
Alternative sequencei17 – 193Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsVSP_028651
Alternative sequencei264 – 29734IRTLR…LTMAV → FPLLPGAVAHACNPSTLGGR GGRITRSGDQDHPG in isoform 5. 1 PublicationVSP_028652Add
BLAST
Alternative sequencei264 – 29431IRTLR…RMYLT → FPLLPGAVAHACNPSTLGGR GGRITRSGRCG in isoform 4. 1 PublicationVSP_028653Add
BLAST
Alternative sequencei295 – 31420Missing in isoform 4. 1 PublicationVSP_028654Add
BLAST
Alternative sequencei298 – 31417Missing in isoform 5. 1 PublicationVSP_028655Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY358965 mRNA. Translation: AAQ89324.1.
AF258578 mRNA. Translation: AAG23781.1.
AL833382 mRNA. Translation: CAI46138.1.
AC011479 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW56772.1.
BC007644 mRNA. Translation: AAH07644.1.
BC014974 mRNA. Translation: AAH14974.1.
BC091477 mRNA. Translation: AAH91477.2.
CCDSiCCDS12512.1. [Q5BJH7-2]
CCDS33010.1. [Q5BJH7-1]
CCDS46066.1. [Q5BJH7-6]
CCDS46067.1. [Q5BJH7-4]
RefSeqiNP_001034760.1. NM_001039671.2. [Q5BJH7-6]
NP_001034761.1. NM_001039672.2. [Q5BJH7-1]
NP_001034762.1. NM_001039673.2. [Q5BJH7-3]
NP_001138933.1. NM_001145461.1.
NP_001138934.1. NM_001145462.1. [Q5BJH7-2]
NP_001138935.1. NM_001145463.1. [Q5BJH7-4]
XP_005259441.1. XM_005259384.2.
XP_005259442.1. XM_005259385.1. [Q5BJH7-2]
UniGeneiHs.280741.

Genome annotation databases

EnsembliENST00000329420; ENSP00000329559; ENSG00000167645. [Q5BJH7-6]
ENST00000337679; ENSP00000337411; ENSG00000167645. [Q5BJH7-4]
ENST00000339413; ENSP00000343435; ENSG00000167645. [Q5BJH7-1]
ENST00000392124; ENSP00000375971; ENSG00000167645. [Q5BJH7-2]
ENST00000591755; ENSP00000465446; ENSG00000167645. [Q5BJH7-5]
ENST00000591784; ENSP00000465230; ENSG00000167645. [Q5BJH7-2]
ENST00000592694; ENSP00000466428; ENSG00000167645. [Q5BJH7-2]
GeneIDi90522.
KEGGihsa:90522.
UCSCiuc002ohw.2. human. [Q5BJH7-1]
uc002ohy.2. human. [Q5BJH7-3]
uc002oia.2. human. [Q5BJH7-4]
uc002oib.3. human. [Q5BJH7-5]

Polymorphism databases

DMDMi121944384.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY358965 mRNA. Translation: AAQ89324.1 .
AF258578 mRNA. Translation: AAG23781.1 .
AL833382 mRNA. Translation: CAI46138.1 .
AC011479 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW56772.1 .
BC007644 mRNA. Translation: AAH07644.1 .
BC014974 mRNA. Translation: AAH14974.1 .
BC091477 mRNA. Translation: AAH91477.2 .
CCDSi CCDS12512.1. [Q5BJH7-2 ]
CCDS33010.1. [Q5BJH7-1 ]
CCDS46066.1. [Q5BJH7-6 ]
CCDS46067.1. [Q5BJH7-4 ]
RefSeqi NP_001034760.1. NM_001039671.2. [Q5BJH7-6 ]
NP_001034761.1. NM_001039672.2. [Q5BJH7-1 ]
NP_001034762.1. NM_001039673.2. [Q5BJH7-3 ]
NP_001138933.1. NM_001145461.1.
NP_001138934.1. NM_001145462.1. [Q5BJH7-2 ]
NP_001138935.1. NM_001145463.1. [Q5BJH7-4 ]
XP_005259441.1. XM_005259384.2.
XP_005259442.1. XM_005259385.1. [Q5BJH7-2 ]
UniGenei Hs.280741.

3D structure databases

ProteinModelPortali Q5BJH7.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124728. 4 interactions.
STRINGi 9606.ENSP00000343435.

PTM databases

PhosphoSitei Q5BJH7.

Polymorphism databases

DMDMi 121944384.

Proteomic databases

MaxQBi Q5BJH7.
PaxDbi Q5BJH7.
PRIDEi Q5BJH7.

Protocols and materials databases

DNASUi 90522.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000329420 ; ENSP00000329559 ; ENSG00000167645 . [Q5BJH7-6 ]
ENST00000337679 ; ENSP00000337411 ; ENSG00000167645 . [Q5BJH7-4 ]
ENST00000339413 ; ENSP00000343435 ; ENSG00000167645 . [Q5BJH7-1 ]
ENST00000392124 ; ENSP00000375971 ; ENSG00000167645 . [Q5BJH7-2 ]
ENST00000591755 ; ENSP00000465446 ; ENSG00000167645 . [Q5BJH7-5 ]
ENST00000591784 ; ENSP00000465230 ; ENSG00000167645 . [Q5BJH7-2 ]
ENST00000592694 ; ENSP00000466428 ; ENSG00000167645 . [Q5BJH7-2 ]
GeneIDi 90522.
KEGGi hsa:90522.
UCSCi uc002ohw.2. human. [Q5BJH7-1 ]
uc002ohy.2. human. [Q5BJH7-3 ]
uc002oia.2. human. [Q5BJH7-4 ]
uc002oib.3. human. [Q5BJH7-5 ]

Organism-specific databases

CTDi 90522.
GeneCardsi GC19M038794.
HGNCi HGNC:30511. YIF1B.
HPAi HPA055257.
neXtProti NX_Q5BJH7.
PharmGKBi PA142670561.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5197.
GeneTreei ENSGT00390000009423.
HOGENOMi HOG000234333.
HOVERGENi HBG053252.
InParanoidi Q5BJH7.
OMAi PMSNLAM.
OrthoDBi EOG7SXW3T.
PhylomeDBi Q5BJH7.
TreeFami TF314528.

Miscellaneous databases

GenomeRNAii 90522.
NextBioi 76803.
PROi Q5BJH7.

Gene expression databases

Bgeei Q5BJH7.
CleanExi HS_YIF1B.
ExpressionAtlasi Q5BJH7. baseline and differential.
Genevestigatori Q5BJH7.

Family and domain databases

InterProi IPR005578. Hrf1.
[Graphical view ]
PANTHERi PTHR14083. PTHR14083. 1 hit.
Pfami PF03878. YIF1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  2. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Lymph node.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-314 (ISOFORM 3).
    Tissue: Colon, Lung and Placenta.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiYIF1B_HUMAN
AccessioniPrimary (citable) accession number: Q5BJH7
Secondary accession number(s): H7BXS8
, Q5JPC2, Q8WY70, Q96C02, Q96IC4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: September 27, 2005
Last modified: October 29, 2014
This is version 73 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3