Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5BJH7

- YIF1B_HUMAN

UniProt

Q5BJH7 - YIF1B_HUMAN

Protein

Protein YIF1B

Gene

YIF1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 72 (01 Oct 2014)
      Sequence version 1 (27 Sep 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein YIF1B
    Alternative name(s):
    YIP1-interacting factor homolog B
    Gene namesi
    Name:YIF1B
    ORF Names:PP4519, UNQ3073/PRO9905
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:30511. YIF1B.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142670561.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 314314Protein YIF1BPRO_0000307258Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionineBy similarity
    Modified residuei13 – 131PhosphothreonineBy similarity
    Modified residuei65 – 651Phosphoserine2 Publications

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ5BJH7.
    PaxDbiQ5BJH7.
    PRIDEiQ5BJH7.

    PTM databases

    PhosphoSiteiQ5BJH7.

    Expressioni

    Gene expression databases

    ArrayExpressiQ5BJH7.
    BgeeiQ5BJH7.
    CleanExiHS_YIF1B.
    GenevestigatoriQ5BJH7.

    Organism-specific databases

    HPAiHPA055257.

    Interactioni

    Protein-protein interaction databases

    BioGridi124728. 2 interactions.
    STRINGi9606.ENSP00000343435.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5BJH7.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 156156CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini178 – 19215ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini214 – 2196CytoplasmicSequence Analysis
    Topological domaini241 – 2411ExtracellularSequence Analysis
    Topological domaini263 – 29230CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini314 – 3141ExtracellularSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei157 – 17721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei193 – 21321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei220 – 24021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei242 – 26221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei293 – 31321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the YIF1 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG5197.
    HOGENOMiHOG000234333.
    HOVERGENiHBG053252.
    InParanoidiQ5BJH7.
    OMAiPMSNLAM.
    OrthoDBiEOG7SXW3T.
    PhylomeDBiQ5BJH7.
    TreeFamiTF314528.

    Family and domain databases

    InterProiIPR005578. Hrf1.
    [Graphical view]
    PANTHERiPTHR14083. PTHR14083. 1 hit.
    PfamiPF03878. YIF1. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5BJH7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MHPAGLAAAA AGTPRLRKWP SKRRIPVSQP GMADPHQLFD DTSSAQSRGY    50
    GAQRAPGGLS YPAASPTPHA AFLADPVSNM AMAYGSSLAA QGKELVDKNI 100
    DRFIPITKLK YYFAVDTMYV GRKLGLLFFP YLHQDWEVQY QQDTPVAPRF 150
    DVNAPDLYIP AMAFITYVLV AGLALGTQDR FSPDLLGLQA SSALAWLTLE 200
    VLAILLSLYL VTVNTDLTTI DLVAFLGYKY VGMIGGVLMG LLFGKIGYYL 250
    VLGWCCVAIF VFMIRTLRLK ILADAAAEGV PVRGARNQLR MYLTMAVAAA 300
    QPMLMYWLTF HLVR 314
    Length:314
    Mass (Da):34,435
    Last modified:September 27, 2005 - v1
    Checksum:i93A2521A3332D3AD
    GO
    Isoform 2 (identifier: Q5BJH7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-31: Missing.

    Show »
    Length:283
    Mass (Da):31,175
    Checksum:iF68245FE42608C59
    GO
    Isoform 3 (identifier: Q5BJH7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         17-19: Missing.

    Show »
    Length:311
    Mass (Da):33,965
    Checksum:i006B7C3F190E281E
    GO
    Isoform 4 (identifier: Q5BJH7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         17-19: Missing.
         264-294: IRTLRLKILADAAAEGVPVRGARNQLRMYLT → FPLLPGAVAHACNPSTLGGRGGRITRSGRCG
         295-314: Missing.

    Show »
    Length:291
    Mass (Da):31,245
    Checksum:i76319390816EF13F
    GO
    Isoform 5 (identifier: Q5BJH7-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         17-19: Missing.
         264-297: IRTLRLKILADAAAEGVPVRGARNQLRMYLTMAV → FPLLPGAVAHACNPSTLGGRGGRITRSGDQDHPG
         298-314: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:294
    Mass (Da):31,579
    Checksum:i3ADFF564F9ED3081
    GO
    Isoform 6 (identifier: Q5BJH7-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: MHPAGLAAAAAGTPRLRKWP → MPGSA

    Note: Gene prediction based on EST data.

    Show »
    Length:299
    Mass (Da):32,825
    Checksum:iD2B3DA4653839855
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti56 – 561P → S.
    Corresponds to variant rs11556992 [ dbSNP | Ensembl ].
    VAR_035385

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3131Missing in isoform 2. 2 PublicationsVSP_028650Add
    BLAST
    Alternative sequencei1 – 2020MHPAG…LRKWP → MPGSA in isoform 6. CuratedVSP_046823Add
    BLAST
    Alternative sequencei17 – 193Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsVSP_028651
    Alternative sequencei264 – 29734IRTLR…LTMAV → FPLLPGAVAHACNPSTLGGR GGRITRSGDQDHPG in isoform 5. 1 PublicationVSP_028652Add
    BLAST
    Alternative sequencei264 – 29431IRTLR…RMYLT → FPLLPGAVAHACNPSTLGGR GGRITRSGRCG in isoform 4. 1 PublicationVSP_028653Add
    BLAST
    Alternative sequencei295 – 31420Missing in isoform 4. 1 PublicationVSP_028654Add
    BLAST
    Alternative sequencei298 – 31417Missing in isoform 5. 1 PublicationVSP_028655Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY358965 mRNA. Translation: AAQ89324.1.
    AF258578 mRNA. Translation: AAG23781.1.
    AL833382 mRNA. Translation: CAI46138.1.
    AC011479 Genomic DNA. No translation available.
    CH471126 Genomic DNA. Translation: EAW56772.1.
    BC007644 mRNA. Translation: AAH07644.1.
    BC014974 mRNA. Translation: AAH14974.1.
    BC091477 mRNA. Translation: AAH91477.2.
    CCDSiCCDS12512.1. [Q5BJH7-2]
    CCDS33010.1. [Q5BJH7-1]
    CCDS46066.1. [Q5BJH7-6]
    CCDS46067.1. [Q5BJH7-4]
    RefSeqiNP_001034760.1. NM_001039671.2. [Q5BJH7-6]
    NP_001034761.1. NM_001039672.2. [Q5BJH7-1]
    NP_001034762.1. NM_001039673.2. [Q5BJH7-3]
    NP_001138933.1. NM_001145461.1.
    NP_001138934.1. NM_001145462.1. [Q5BJH7-2]
    NP_001138935.1. NM_001145463.1. [Q5BJH7-4]
    NP_291035.1. NM_033557.3. [Q5BJH7-2]
    XP_005259441.1. XM_005259384.2.
    XP_005259442.1. XM_005259385.1. [Q5BJH7-2]
    UniGeneiHs.280741.

    Genome annotation databases

    EnsembliENST00000329420; ENSP00000329559; ENSG00000167645. [Q5BJH7-6]
    ENST00000337679; ENSP00000337411; ENSG00000167645. [Q5BJH7-4]
    ENST00000339413; ENSP00000343435; ENSG00000167645. [Q5BJH7-1]
    ENST00000392124; ENSP00000375971; ENSG00000167645. [Q5BJH7-2]
    ENST00000591755; ENSP00000465446; ENSG00000167645. [Q5BJH7-5]
    ENST00000591784; ENSP00000465230; ENSG00000167645. [Q5BJH7-2]
    ENST00000592694; ENSP00000466428; ENSG00000167645. [Q5BJH7-2]
    GeneIDi90522.
    KEGGihsa:90522.
    UCSCiuc002ohw.2. human. [Q5BJH7-1]
    uc002ohy.2. human. [Q5BJH7-3]
    uc002oia.2. human. [Q5BJH7-4]
    uc002oib.3. human. [Q5BJH7-5]

    Polymorphism databases

    DMDMi121944384.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY358965 mRNA. Translation: AAQ89324.1 .
    AF258578 mRNA. Translation: AAG23781.1 .
    AL833382 mRNA. Translation: CAI46138.1 .
    AC011479 Genomic DNA. No translation available.
    CH471126 Genomic DNA. Translation: EAW56772.1 .
    BC007644 mRNA. Translation: AAH07644.1 .
    BC014974 mRNA. Translation: AAH14974.1 .
    BC091477 mRNA. Translation: AAH91477.2 .
    CCDSi CCDS12512.1. [Q5BJH7-2 ]
    CCDS33010.1. [Q5BJH7-1 ]
    CCDS46066.1. [Q5BJH7-6 ]
    CCDS46067.1. [Q5BJH7-4 ]
    RefSeqi NP_001034760.1. NM_001039671.2. [Q5BJH7-6 ]
    NP_001034761.1. NM_001039672.2. [Q5BJH7-1 ]
    NP_001034762.1. NM_001039673.2. [Q5BJH7-3 ]
    NP_001138933.1. NM_001145461.1.
    NP_001138934.1. NM_001145462.1. [Q5BJH7-2 ]
    NP_001138935.1. NM_001145463.1. [Q5BJH7-4 ]
    NP_291035.1. NM_033557.3. [Q5BJH7-2 ]
    XP_005259441.1. XM_005259384.2.
    XP_005259442.1. XM_005259385.1. [Q5BJH7-2 ]
    UniGenei Hs.280741.

    3D structure databases

    ProteinModelPortali Q5BJH7.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124728. 2 interactions.
    STRINGi 9606.ENSP00000343435.

    PTM databases

    PhosphoSitei Q5BJH7.

    Polymorphism databases

    DMDMi 121944384.

    Proteomic databases

    MaxQBi Q5BJH7.
    PaxDbi Q5BJH7.
    PRIDEi Q5BJH7.

    Protocols and materials databases

    DNASUi 90522.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000329420 ; ENSP00000329559 ; ENSG00000167645 . [Q5BJH7-6 ]
    ENST00000337679 ; ENSP00000337411 ; ENSG00000167645 . [Q5BJH7-4 ]
    ENST00000339413 ; ENSP00000343435 ; ENSG00000167645 . [Q5BJH7-1 ]
    ENST00000392124 ; ENSP00000375971 ; ENSG00000167645 . [Q5BJH7-2 ]
    ENST00000591755 ; ENSP00000465446 ; ENSG00000167645 . [Q5BJH7-5 ]
    ENST00000591784 ; ENSP00000465230 ; ENSG00000167645 . [Q5BJH7-2 ]
    ENST00000592694 ; ENSP00000466428 ; ENSG00000167645 . [Q5BJH7-2 ]
    GeneIDi 90522.
    KEGGi hsa:90522.
    UCSCi uc002ohw.2. human. [Q5BJH7-1 ]
    uc002ohy.2. human. [Q5BJH7-3 ]
    uc002oia.2. human. [Q5BJH7-4 ]
    uc002oib.3. human. [Q5BJH7-5 ]

    Organism-specific databases

    CTDi 90522.
    GeneCardsi GC19M038794.
    HGNCi HGNC:30511. YIF1B.
    HPAi HPA055257.
    neXtProti NX_Q5BJH7.
    PharmGKBi PA142670561.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5197.
    HOGENOMi HOG000234333.
    HOVERGENi HBG053252.
    InParanoidi Q5BJH7.
    OMAi PMSNLAM.
    OrthoDBi EOG7SXW3T.
    PhylomeDBi Q5BJH7.
    TreeFami TF314528.

    Miscellaneous databases

    GenomeRNAii 90522.
    NextBioi 76803.
    PROi Q5BJH7.

    Gene expression databases

    ArrayExpressi Q5BJH7.
    Bgeei Q5BJH7.
    CleanExi HS_YIF1B.
    Genevestigatori Q5BJH7.

    Family and domain databases

    InterProi IPR005578. Hrf1.
    [Graphical view ]
    PANTHERi PTHR14083. PTHR14083. 1 hit.
    Pfami PF03878. YIF1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    2. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
      Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
      , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
      Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Lymph node.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-314 (ISOFORM 3).
      Tissue: Colon, Lung and Placenta.
    7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiYIF1B_HUMAN
    AccessioniPrimary (citable) accession number: Q5BJH7
    Secondary accession number(s): H7BXS8
    , Q5JPC2, Q8WY70, Q96C02, Q96IC4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 23, 2007
    Last sequence update: September 27, 2005
    Last modified: October 1, 2014
    This is version 72 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3