Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein YIF1B

Gene

YIF1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein YIF1B
Alternative name(s):
YIP1-interacting factor homolog B
Gene namesi
Name:YIF1B
ORF Names:PP4519, UNQ3073/PRO9905
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:30511. YIF1B.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 156CytoplasmicSequence analysisAdd BLAST156
Transmembranei157 – 177HelicalSequence analysisAdd BLAST21
Topological domaini178 – 192ExtracellularSequence analysisAdd BLAST15
Transmembranei193 – 213HelicalSequence analysisAdd BLAST21
Topological domaini214 – 219CytoplasmicSequence analysis6
Transmembranei220 – 240HelicalSequence analysisAdd BLAST21
Topological domaini241ExtracellularSequence analysis1
Transmembranei242 – 262HelicalSequence analysisAdd BLAST21
Topological domaini263 – 292CytoplasmicSequence analysisAdd BLAST30
Transmembranei293 – 313HelicalSequence analysisAdd BLAST21
Topological domaini314ExtracellularSequence analysis1

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000167645.
PharmGKBiPA142670561.

Polymorphism and mutation databases

BioMutaiYIF1B.
DMDMi121944384.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003072581 – 314Protein YIF1BAdd BLAST314

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei13PhosphothreonineBy similarity1
Modified residuei65PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ5BJH7.
MaxQBiQ5BJH7.
PaxDbiQ5BJH7.
PeptideAtlasiQ5BJH7.
PRIDEiQ5BJH7.

PTM databases

iPTMnetiQ5BJH7.
PhosphoSitePlusiQ5BJH7.

Expressioni

Gene expression databases

BgeeiENSG00000167645.
CleanExiHS_YIF1B.
ExpressionAtlasiQ5BJH7. baseline and differential.
GenevisibleiQ5BJH7. HS.

Organism-specific databases

HPAiHPA055257.

Interactioni

Protein-protein interaction databases

BioGridi124728. 9 interactors.
IntActiQ5BJH7. 6 interactors.
STRINGi9606.ENSP00000343435.

Structurei

3D structure databases

ProteinModelPortaliQ5BJH7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the YIF1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3094. Eukaryota.
COG5197. LUCA.
GeneTreeiENSGT00390000009423.
HOGENOMiHOG000234333.
HOVERGENiHBG053252.
InParanoidiQ5BJH7.
KOiK20362.
OMAiPRQRKWP.
OrthoDBiEOG091G0H35.
PhylomeDBiQ5BJH7.
TreeFamiTF314528.

Family and domain databases

InterProiIPR005578. Yif1_fam.
[Graphical view]
PANTHERiPTHR14083. PTHR14083. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5BJH7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHPAGLAAAA AGTPRLRKWP SKRRIPVSQP GMADPHQLFD DTSSAQSRGY
60 70 80 90 100
GAQRAPGGLS YPAASPTPHA AFLADPVSNM AMAYGSSLAA QGKELVDKNI
110 120 130 140 150
DRFIPITKLK YYFAVDTMYV GRKLGLLFFP YLHQDWEVQY QQDTPVAPRF
160 170 180 190 200
DVNAPDLYIP AMAFITYVLV AGLALGTQDR FSPDLLGLQA SSALAWLTLE
210 220 230 240 250
VLAILLSLYL VTVNTDLTTI DLVAFLGYKY VGMIGGVLMG LLFGKIGYYL
260 270 280 290 300
VLGWCCVAIF VFMIRTLRLK ILADAAAEGV PVRGARNQLR MYLTMAVAAA
310
QPMLMYWLTF HLVR
Length:314
Mass (Da):34,435
Last modified:September 27, 2005 - v1
Checksum:i93A2521A3332D3AD
GO
Isoform 2 (identifier: Q5BJH7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.

Show »
Length:283
Mass (Da):31,175
Checksum:iF68245FE42608C59
GO
Isoform 3 (identifier: Q5BJH7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.

Show »
Length:311
Mass (Da):33,965
Checksum:i006B7C3F190E281E
GO
Isoform 4 (identifier: Q5BJH7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.
     264-294: IRTLRLKILADAAAEGVPVRGARNQLRMYLT → FPLLPGAVAHACNPSTLGGRGGRITRSGRCG
     295-314: Missing.

Show »
Length:291
Mass (Da):31,245
Checksum:i76319390816EF13F
GO
Isoform 5 (identifier: Q5BJH7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.
     264-297: IRTLRLKILADAAAEGVPVRGARNQLRMYLTMAV → FPLLPGAVAHACNPSTLGGRGGRITRSGDQDHPG
     298-314: Missing.

Note: No experimental confirmation available.
Show »
Length:294
Mass (Da):31,579
Checksum:i3ADFF564F9ED3081
GO
Isoform 6 (identifier: Q5BJH7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MHPAGLAAAAAGTPRLRKWP → MPGSA

Note: Gene prediction based on EST data.
Show »
Length:299
Mass (Da):32,825
Checksum:iD2B3DA4653839855
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03538556P → S.Corresponds to variant rs11556992dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0286501 – 31Missing in isoform 2. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_0468231 – 20MHPAG…LRKWP → MPGSA in isoform 6. CuratedAdd BLAST20
Alternative sequenceiVSP_02865117 – 19Missing in isoform 3, isoform 4 and isoform 5. 2 Publications3
Alternative sequenceiVSP_028652264 – 297IRTLR…LTMAV → FPLLPGAVAHACNPSTLGGR GGRITRSGDQDHPG in isoform 5. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_028653264 – 294IRTLR…RMYLT → FPLLPGAVAHACNPSTLGGR GGRITRSGRCG in isoform 4. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_028654295 – 314Missing in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_028655298 – 314Missing in isoform 5. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358965 mRNA. Translation: AAQ89324.1.
AF258578 mRNA. Translation: AAG23781.1.
AL833382 mRNA. Translation: CAI46138.1.
AC011479 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW56772.1.
BC007644 mRNA. Translation: AAH07644.1.
BC014974 mRNA. Translation: AAH14974.1.
BC091477 mRNA. Translation: AAH91477.2.
CCDSiCCDS12512.1. [Q5BJH7-2]
CCDS33010.1. [Q5BJH7-1]
CCDS46066.1. [Q5BJH7-6]
CCDS46067.1. [Q5BJH7-4]
RefSeqiNP_001034761.1. NM_001039672.2. [Q5BJH7-1]
NP_001034762.1. NM_001039673.2. [Q5BJH7-3]
NP_001138934.1. NM_001145462.1. [Q5BJH7-2]
NP_001138935.1. NM_001145463.1. [Q5BJH7-4]
XP_005259442.1. XM_005259385.3. [Q5BJH7-2]
XP_016882938.1. XM_017027449.1. [Q5BJH7-5]
UniGeneiHs.280741.

Genome annotation databases

EnsembliENST00000329420; ENSP00000329559; ENSG00000167645. [Q5BJH7-6]
ENST00000337679; ENSP00000337411; ENSG00000167645. [Q5BJH7-4]
ENST00000339413; ENSP00000343435; ENSG00000167645. [Q5BJH7-1]
ENST00000392124; ENSP00000375971; ENSG00000167645. [Q5BJH7-2]
ENST00000591755; ENSP00000465446; ENSG00000167645. [Q5BJH7-5]
ENST00000591784; ENSP00000465230; ENSG00000167645. [Q5BJH7-2]
ENST00000592694; ENSP00000466428; ENSG00000167645. [Q5BJH7-2]
GeneIDi90522.
KEGGihsa:90522.
UCSCiuc002ohw.3. human. [Q5BJH7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358965 mRNA. Translation: AAQ89324.1.
AF258578 mRNA. Translation: AAG23781.1.
AL833382 mRNA. Translation: CAI46138.1.
AC011479 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW56772.1.
BC007644 mRNA. Translation: AAH07644.1.
BC014974 mRNA. Translation: AAH14974.1.
BC091477 mRNA. Translation: AAH91477.2.
CCDSiCCDS12512.1. [Q5BJH7-2]
CCDS33010.1. [Q5BJH7-1]
CCDS46066.1. [Q5BJH7-6]
CCDS46067.1. [Q5BJH7-4]
RefSeqiNP_001034761.1. NM_001039672.2. [Q5BJH7-1]
NP_001034762.1. NM_001039673.2. [Q5BJH7-3]
NP_001138934.1. NM_001145462.1. [Q5BJH7-2]
NP_001138935.1. NM_001145463.1. [Q5BJH7-4]
XP_005259442.1. XM_005259385.3. [Q5BJH7-2]
XP_016882938.1. XM_017027449.1. [Q5BJH7-5]
UniGeneiHs.280741.

3D structure databases

ProteinModelPortaliQ5BJH7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124728. 9 interactors.
IntActiQ5BJH7. 6 interactors.
STRINGi9606.ENSP00000343435.

PTM databases

iPTMnetiQ5BJH7.
PhosphoSitePlusiQ5BJH7.

Polymorphism and mutation databases

BioMutaiYIF1B.
DMDMi121944384.

Proteomic databases

EPDiQ5BJH7.
MaxQBiQ5BJH7.
PaxDbiQ5BJH7.
PeptideAtlasiQ5BJH7.
PRIDEiQ5BJH7.

Protocols and materials databases

DNASUi90522.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329420; ENSP00000329559; ENSG00000167645. [Q5BJH7-6]
ENST00000337679; ENSP00000337411; ENSG00000167645. [Q5BJH7-4]
ENST00000339413; ENSP00000343435; ENSG00000167645. [Q5BJH7-1]
ENST00000392124; ENSP00000375971; ENSG00000167645. [Q5BJH7-2]
ENST00000591755; ENSP00000465446; ENSG00000167645. [Q5BJH7-5]
ENST00000591784; ENSP00000465230; ENSG00000167645. [Q5BJH7-2]
ENST00000592694; ENSP00000466428; ENSG00000167645. [Q5BJH7-2]
GeneIDi90522.
KEGGihsa:90522.
UCSCiuc002ohw.3. human. [Q5BJH7-1]

Organism-specific databases

CTDi90522.
GeneCardsiYIF1B.
HGNCiHGNC:30511. YIF1B.
HPAiHPA055257.
neXtProtiNX_Q5BJH7.
OpenTargetsiENSG00000167645.
PharmGKBiPA142670561.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3094. Eukaryota.
COG5197. LUCA.
GeneTreeiENSGT00390000009423.
HOGENOMiHOG000234333.
HOVERGENiHBG053252.
InParanoidiQ5BJH7.
KOiK20362.
OMAiPRQRKWP.
OrthoDBiEOG091G0H35.
PhylomeDBiQ5BJH7.
TreeFamiTF314528.

Miscellaneous databases

ChiTaRSiYIF1B. human.
GenomeRNAii90522.
PROiQ5BJH7.

Gene expression databases

BgeeiENSG00000167645.
CleanExiHS_YIF1B.
ExpressionAtlasiQ5BJH7. baseline and differential.
GenevisibleiQ5BJH7. HS.

Family and domain databases

InterProiIPR005578. Yif1_fam.
[Graphical view]
PANTHERiPTHR14083. PTHR14083. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiYIF1B_HUMAN
AccessioniPrimary (citable) accession number: Q5BJH7
Secondary accession number(s): H7BXS8
, Q5JPC2, Q8WY70, Q96C02, Q96IC4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: September 27, 2005
Last modified: November 30, 2016
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.