Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Outer dense fiber protein 2

Gene

ODF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly.1 Publication

GO - Molecular functioni

  • Rab GTPase binding Source: UniProtKB
  • structural molecule activity Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Enzyme and pathway databases

ReactomeiREACT_15296. Recruitment of mitotic centrosome proteins and complexes.
REACT_15364. Loss of Nlp from mitotic centrosomes.
REACT_15451. Loss of proteins required for interphase microtubule organization from the centrosome.
REACT_160315. Regulation of PLK1 Activity at G2/M Transition.
REACT_267965. Anchoring of the basal body to the plasma membrane.

Names & Taxonomyi

Protein namesi
Recommended name:
Outer dense fiber protein 2
Alternative name(s):
Cenexin
Outer dense fiber of sperm tails protein 2
Gene namesi
Name:ODF2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:8114. ODF2.

Subcellular locationi

GO - Cellular componenti

  • centriole Source: UniProtKB
  • centrosome Source: UniProtKB
  • ciliary basal body Source: UniProtKB
  • cytosol Source: Reactome
  • microtubule Source: UniProtKB-KW
  • nucleus Source: UniProtKB
  • outer dense fiber Source: Ensembl
  • primary cilium Source: UniProtKB
  • spindle pole Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31902.

Polymorphism and mutation databases

BioMutaiODF2.
DMDMi74736013.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 829829Outer dense fiber protein 2PRO_0000299455Add
BLAST

Post-translational modificationi

Tyrosine phosphorylated.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ5BJF6.
PaxDbiQ5BJF6.
PRIDEiQ5BJF6.

PTM databases

PhosphoSiteiQ5BJF6.

Expressioni

Tissue specificityi

Testis-specific (at protein level). Highly expressed in cytoplasm of step 2 round spermatids. Detected in the middle piece and extends to about half the principal piece of the sperm tails.1 Publication

Gene expression databases

BgeeiQ5BJF6.
CleanExiHS_ODF2.
ExpressionAtlasiQ5BJF6. baseline and differential.
GenevisibleiQ5BJF6. HS.

Organism-specific databases

HPAiHPA001874.
HPA048841.

Interactioni

Subunit structurei

Self-associates. Associates with microtubules and forms a fibrillar structure partially linked to the microtubule network. Interacts via its C-terminus with PLK1. Interacts with ODF1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi111010. 12 interactions.
IntActiQ5BJF6. 4 interactions.
STRINGi9606.ENSP00000361882.

Structurei

3D structure databases

ProteinModelPortaliQ5BJF6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili144 – 21774Sequence AnalysisAdd
BLAST
Coiled coili245 – 423179Sequence AnalysisAdd
BLAST
Coiled coili461 – 798338Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the ODF2 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG116573.
GeneTreeiENSGT00530000063497.
HOGENOMiHOG000246967.
HOVERGENiHBG052808.
InParanoidiQ5BJF6.
KOiK16479.
OMAiWAEENSH.
OrthoDBiEOG780RKV.
PhylomeDBiQ5BJF6.
TreeFamiTF328605.

Family and domain databases

InterProiIPR026099. Odf2-rel.
[Graphical view]
PANTHERiPTHR23162. PTHR23162. 1 hit.

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5BJF6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSASSSGGSP RFPSCGKNGV TSLTQKKVLR APCGAPSVTV TKSHKRGMKG
60 70 80 90 100
DTVNVRRSVR VKTKVPWMPP GKSSARPVGC KWENPPHCLE ITPPSSEKLV
110 120 130 140 150
SVMRLSDLST EDDDSGHCKM NRYDKKIDSL MNAVGCLKSE VKMQKGERQM
160 170 180 190 200
AKRFLEERKE ELEEVAHELA ETEHENTVLR HNIERMKEEK DFTILQKKHL
210 220 230 240 250
QQEKECLMSK LVEAEMDGAA AAKQVMALKD TIGKLKTEKQ MTCTDINTLT
260 270 280 290 300
RQKELLLQKL STFEETNRTL RDLLREQHCK EDSERLMEQQ GALLKRLAEA
310 320 330 340 350
DSEKARLLLL LQDKDKEVEE LLQEIQCEKA QAKTASELSK SMESMRGHLQ
360 370 380 390 400
AQLRSKEAEN SRLCMQIKNL ERSGNQHKAE VEAIMEQLKE LKQKGDRDKE
410 420 430 440 450
SLKKAIRAQK ERAEKSEEYA EQLHVQLADK DLYVAEALST LESWRSRYNQ
460 470 480 490 500
VVKEKGDLEL EIIVLNDRVT DLVNQQQTLE EKMREDRDSL VERLHRQTAE
510 520 530 540 550
YSAFKLENER LKASFAPMED KLNQAHLEVQ QLKASVKNYE GMIDNYKSQV
560 570 580 590 600
MKTRLEADEV AAQLERCDKE NKILKDEMNK EIEAARRQFQ SQLADLQQLP
610 620 630 640 650
DILKITEAKL AECQDQLQGY ERKNIDLTAI ISDLRSRIEH QGDKLEMARE
660 670 680 690 700
KHQASQKENK QLSLKVDELE RKLEATSAQN IEFLQVIAKR EEAIHQSQLR
710 720 730 740 750
LEEKTRECGT LARQLESAIE DARRQVEQTK EHALSKERAA QNKILDLETQ
760 770 780 790 800
LSRTKTELSQ LRRSRDDADR RYQSRLQDLK DRLEQSESTN RSMQNYVQFL
810 820
KSSYANVFGD GPYSTFLTSS PIRSRSPPA
Length:829
Mass (Da):95,401
Last modified:April 12, 2005 - v1
Checksum:iCF49166AD9003BEB
GO
Isoform 2 (identifier: Q5BJF6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.
     65-83: Missing.

Note: No experimental confirmation available.
Show »
Length:763
Mass (Da):88,578
Checksum:i5055A59E4E74DF9C
GO
Isoform 3 (identifier: Q5BJF6-3) [UniParc]FASTAAdd to basket

Also known as: Cenexin 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ
     65-83: Missing.

Show »
Length:805
Mass (Da):93,254
Checksum:i1321EE3AC5FCF622
GO
Isoform 4 (identifier: Q5BJF6-4) [UniParc]FASTAAdd to basket

Also known as: Cenexin 1 variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ

Show »
Length:824
Mass (Da):95,348
Checksum:i166CFD3FA9F93215
GO
Isoform 5 (identifier: Q5BJF6-5) [UniParc]FASTAAdd to basket

Also known as: Cenexin 1, ODF2/1

The sequence of this isoform differs from the canonical sequence as follows:
     65-83: Missing.
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Note: Major.
Show »
Length:638
Mass (Da):73,339
Checksum:iB7625F274EDB1EAB
GO
Isoform 6 (identifier: Q5BJF6-6) [UniParc]FASTAAdd to basket

Also known as: Isoform 3, ODF2/2

The sequence of this isoform differs from the canonical sequence as follows:
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Show »
Length:657
Mass (Da):75,433
Checksum:iAC80174E5B017689
GO
Isoform 7 (identifier: Q5BJF6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSASSSGGSPR → MGELPTGCRKRRRKRGGAAARARLHPPRRLHGTTLASDFNDFIRRRFWAQPCRSW
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Show »
Length:701
Mass (Da):80,886
Checksum:i78681E3A810390B4
GO
Isoform 8 (identifier: Q5BJF6-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSASSSGGSPR → MGRNRYPPACW
     65-83: Missing.
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Show »
Length:638
Mass (Da):73,666
Checksum:iC7C7CFFF669EC468
GO
Isoform 9 (identifier: Q5BJF6-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ
     65-140: Missing.
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Show »
Length:576
Mass (Da):66,967
Checksum:iA8B1A574A75B89E5
GO
Isoform 10 (identifier: Q5BJF6-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MSASSSGGSP → MADQQGPHQN
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Note: No experimental confirmation available.
Show »
Length:657
Mass (Da):75,691
Checksum:iD01296974EBEA8F5
GO

Sequence cautioni

The sequence AAC08409.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti39 – 391T → A in AAP83847 (Ref. 3) Curated
Sequence conflicti194 – 1941I → R in AAP83847 (Ref. 3) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti710 – 7101T → S.
Corresponds to variant rs16930426 [ dbSNP | Ensembl ].
VAR_034821

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4747Missing in isoform 2. 1 PublicationVSP_027665Add
BLAST
Alternative sequencei1 – 4141MSASS…SVTVT → MKDRSSTPPLHVHVDENTPV HVHIKKLPKPSATSSQ in isoform 3, isoform 4 and isoform 9. 3 PublicationsVSP_027666Add
BLAST
Alternative sequencei1 – 1111MSASSSGGSPR → MGELPTGCRKRRRKRGGAAA RARLHPPRRLHGTTLASDFN DFIRRRFWAQPCRSW in isoform 7. CuratedVSP_042071Add
BLAST
Alternative sequencei1 – 1111MSASSSGGSPR → MGRNRYPPACW in isoform 8. CuratedVSP_042070Add
BLAST
Alternative sequencei1 – 1010MSASSSGGSP → MADQQGPHQN in isoform 10. 1 PublicationVSP_044946
Alternative sequencei65 – 14076Missing in isoform 9. CuratedVSP_042072Add
BLAST
Alternative sequencei65 – 8319Missing in isoform 2, isoform 3, isoform 5 and isoform 8. 4 PublicationsVSP_027667Add
BLAST
Alternative sequencei638 – 65720IEHQG…QASQK → VRDWQKGSHELTRAGARIPR in isoform 5, isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10. 3 PublicationsVSP_027668Add
BLAST
Alternative sequencei658 – 829172Missing in isoform 5, isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10. 3 PublicationsVSP_027669Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF012549 mRNA. Translation: AAB66337.1.
AF053970 mRNA. Translation: AAC08409.1. Different initiation.
DQ444713 mRNA. Translation: ABE01856.1.
DQ444714 mRNA. Translation: ABE01857.1.
AY319414 mRNA. Translation: AAP83847.1.
AY366499 mRNA. Translation: AAQ73195.1.
AK299303 mRNA. Translation: BAG61316.1.
AK301842 mRNA. Translation: BAG63285.1.
AK302684 mRNA. Translation: BAG63914.1.
AL445287, AL359091 Genomic DNA. Translation: CAH71066.1.
AL445287, AL359091 Genomic DNA. Translation: CAH71067.1.
AL445287, AL359091 Genomic DNA. Translation: CAH71069.1.
AL359091, AL445287 Genomic DNA. Translation: CAI13499.1.
AL359091, AL445287 Genomic DNA. Translation: CAI13500.1.
AL359091, AL445287 Genomic DNA. Translation: CAI13506.1.
CH471090 Genomic DNA. Translation: EAW87791.1.
CH471090 Genomic DNA. Translation: EAW87793.1.
CH471090 Genomic DNA. Translation: EAW87795.1.
BC091500 mRNA. Translation: AAH91500.1.
BC010629 mRNA. Translation: AAH10629.1.
CCDSiCCDS56585.1. [Q5BJF6-10]
CCDS56586.1. [Q5BJF6-7]
CCDS56587.1. [Q5BJF6-8]
CCDS56588.1. [Q5BJF6-1]
CCDS56589.1. [Q5BJF6-9]
CCDS56590.1. [Q5BJF6-4]
CCDS6902.1. [Q5BJF6-5]
PIRiT03791.
RefSeqiNP_001229281.1. NM_001242352.1. [Q5BJF6-4]
NP_001229282.1. NM_001242353.1. [Q5BJF6-1]
NP_001229283.1. NM_001242354.1. [Q5BJF6-9]
NP_002531.3. NM_002540.4. [Q5BJF6-3]
NP_702910.1. NM_153432.1. [Q5BJF6-7]
NP_702911.1. NM_153433.1. [Q5BJF6-1]
NP_702913.1. NM_153435.1.
NP_702914.1. NM_153436.1. [Q5BJF6-10]
NP_702915.1. NM_153437.2. [Q5BJF6-5]
XP_006717189.1. XM_006717126.2. [Q5BJF6-1]
UniGeneiHs.129055.

Genome annotation databases

EnsembliENST00000351030; ENSP00000342581; ENSG00000136811. [Q5BJF6-4]
ENST00000372807; ENSP00000361893; ENSG00000136811. [Q5BJF6-4]
ENST00000372814; ENSP00000361901; ENSG00000136811. [Q5BJF6-7]
ENST00000393533; ENSP00000377166; ENSG00000136811. [Q5BJF6-10]
ENST00000434106; ENSP00000403453; ENSG00000136811.
ENST00000448249; ENSP00000396687; ENSG00000136811. [Q5BJF6-9]
ENST00000546203; ENSP00000437579; ENSG00000136811. [Q5BJF6-8]
ENST00000604420; ENSP00000473949; ENSG00000136811.
GeneIDi4957.
KEGGihsa:4957.
UCSCiuc004bva.3. human. [Q5BJF6-7]
uc004bvb.3. human. [Q5BJF6-3]
uc004bvd.4. human. [Q5BJF6-1]
uc004bve.3. human. [Q5BJF6-5]
uc011maz.2. human.
uc011mbc.2. human. [Q5BJF6-9]
uc011mbe.2. human. [Q5BJF6-4]
uc011mbf.2. human. [Q5BJF6-8]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF012549 mRNA. Translation: AAB66337.1.
AF053970 mRNA. Translation: AAC08409.1. Different initiation.
DQ444713 mRNA. Translation: ABE01856.1.
DQ444714 mRNA. Translation: ABE01857.1.
AY319414 mRNA. Translation: AAP83847.1.
AY366499 mRNA. Translation: AAQ73195.1.
AK299303 mRNA. Translation: BAG61316.1.
AK301842 mRNA. Translation: BAG63285.1.
AK302684 mRNA. Translation: BAG63914.1.
AL445287, AL359091 Genomic DNA. Translation: CAH71066.1.
AL445287, AL359091 Genomic DNA. Translation: CAH71067.1.
AL445287, AL359091 Genomic DNA. Translation: CAH71069.1.
AL359091, AL445287 Genomic DNA. Translation: CAI13499.1.
AL359091, AL445287 Genomic DNA. Translation: CAI13500.1.
AL359091, AL445287 Genomic DNA. Translation: CAI13506.1.
CH471090 Genomic DNA. Translation: EAW87791.1.
CH471090 Genomic DNA. Translation: EAW87793.1.
CH471090 Genomic DNA. Translation: EAW87795.1.
BC091500 mRNA. Translation: AAH91500.1.
BC010629 mRNA. Translation: AAH10629.1.
CCDSiCCDS56585.1. [Q5BJF6-10]
CCDS56586.1. [Q5BJF6-7]
CCDS56587.1. [Q5BJF6-8]
CCDS56588.1. [Q5BJF6-1]
CCDS56589.1. [Q5BJF6-9]
CCDS56590.1. [Q5BJF6-4]
CCDS6902.1. [Q5BJF6-5]
PIRiT03791.
RefSeqiNP_001229281.1. NM_001242352.1. [Q5BJF6-4]
NP_001229282.1. NM_001242353.1. [Q5BJF6-1]
NP_001229283.1. NM_001242354.1. [Q5BJF6-9]
NP_002531.3. NM_002540.4. [Q5BJF6-3]
NP_702910.1. NM_153432.1. [Q5BJF6-7]
NP_702911.1. NM_153433.1. [Q5BJF6-1]
NP_702913.1. NM_153435.1.
NP_702914.1. NM_153436.1. [Q5BJF6-10]
NP_702915.1. NM_153437.2. [Q5BJF6-5]
XP_006717189.1. XM_006717126.2. [Q5BJF6-1]
UniGeneiHs.129055.

3D structure databases

ProteinModelPortaliQ5BJF6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111010. 12 interactions.
IntActiQ5BJF6. 4 interactions.
STRINGi9606.ENSP00000361882.

PTM databases

PhosphoSiteiQ5BJF6.

Polymorphism and mutation databases

BioMutaiODF2.
DMDMi74736013.

Proteomic databases

MaxQBiQ5BJF6.
PaxDbiQ5BJF6.
PRIDEiQ5BJF6.

Protocols and materials databases

DNASUi4957.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000351030; ENSP00000342581; ENSG00000136811. [Q5BJF6-4]
ENST00000372807; ENSP00000361893; ENSG00000136811. [Q5BJF6-4]
ENST00000372814; ENSP00000361901; ENSG00000136811. [Q5BJF6-7]
ENST00000393533; ENSP00000377166; ENSG00000136811. [Q5BJF6-10]
ENST00000434106; ENSP00000403453; ENSG00000136811.
ENST00000448249; ENSP00000396687; ENSG00000136811. [Q5BJF6-9]
ENST00000546203; ENSP00000437579; ENSG00000136811. [Q5BJF6-8]
ENST00000604420; ENSP00000473949; ENSG00000136811.
GeneIDi4957.
KEGGihsa:4957.
UCSCiuc004bva.3. human. [Q5BJF6-7]
uc004bvb.3. human. [Q5BJF6-3]
uc004bvd.4. human. [Q5BJF6-1]
uc004bve.3. human. [Q5BJF6-5]
uc011maz.2. human.
uc011mbc.2. human. [Q5BJF6-9]
uc011mbe.2. human. [Q5BJF6-4]
uc011mbf.2. human. [Q5BJF6-8]

Organism-specific databases

CTDi4957.
GeneCardsiGC09P131218.
HGNCiHGNC:8114. ODF2.
HPAiHPA001874.
HPA048841.
MIMi602015. gene.
neXtProtiNX_Q5BJF6.
PharmGKBiPA31902.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG116573.
GeneTreeiENSGT00530000063497.
HOGENOMiHOG000246967.
HOVERGENiHBG052808.
InParanoidiQ5BJF6.
KOiK16479.
OMAiWAEENSH.
OrthoDBiEOG780RKV.
PhylomeDBiQ5BJF6.
TreeFamiTF328605.

Enzyme and pathway databases

ReactomeiREACT_15296. Recruitment of mitotic centrosome proteins and complexes.
REACT_15364. Loss of Nlp from mitotic centrosomes.
REACT_15451. Loss of proteins required for interphase microtubule organization from the centrosome.
REACT_160315. Regulation of PLK1 Activity at G2/M Transition.
REACT_267965. Anchoring of the basal body to the plasma membrane.

Miscellaneous databases

ChiTaRSiODF2. human.
GeneWikiiODF2.
GenomeRNAii4957.
NextBioi19090.
PROiQ5BJF6.
SOURCEiSearch...

Gene expression databases

BgeeiQ5BJF6.
CleanExiHS_ODF2.
ExpressionAtlasiQ5BJF6. baseline and differential.
GenevisibleiQ5BJF6. HS.

Family and domain databases

InterProiIPR026099. Odf2-rel.
[Graphical view]
PANTHERiPTHR23162. PTHR23162. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Outer dense fibre proteins from human sperm tail: molecular cloning and expression analyses of two cDNA transcripts encoding proteins of approximately 70 kDa."
    Petersen C., Fuezesi L., Hoyer-Fender S.
    Mol. Hum. Reprod. 5:627-635(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [MRNA] OF 18-829 (ISOFORM 6), TISSUE SPECIFICITY.
    Tissue: Testis.
  2. "Requirement of hCenexin for proper mitotic functions of polo-like kinase 1 at the centrosomes."
    Soung N.-K., Kang Y.H., Kim K., Kamijo K., Yoon H., Seong Y.S., Kuo Y.-L., Miki T., Kim S.R., Kuriyama R., Giam C.-Z., Ahn C.H., Lee K.S.
    Mol. Cell. Biol. 26:8316-8335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), FUNCTION, ALTERNATIVE SPLICING, INTERACTION WITH PLK1.
  3. "Cloning and characterization of the outer dense fiber protein in spermatogenesis."
    Xu Z.Y., Huang X.Y., Yin L.L., Xu M., Lu L., Li J.M., Zhou Z.M., Sha J.H.
    Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 6).
    Tissue: Testis.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 10).
    Tissue: Testis.
  5. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Eye and Testis.
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiODFP2_HUMAN
AccessioniPrimary (citable) accession number: Q5BJF6
Secondary accession number(s): B1AND3
, B4DRK4, B4DX73, B4DZ02, E7EWL2, F5H6J4, O14721, O60631, Q1W2J6, Q6UN26, Q7Z5I6, Q96FN2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: April 12, 2005
Last modified: July 22, 2015
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.