Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5BJF6 (ODFP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 80. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Outer dense fiber protein 2
Alternative name(s):
Cenexin
Outer dense fiber of sperm tails protein 2
Gene names
Name:ODF2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length829 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly. Ref.2

Subunit structure

Self-associates. Associates with microtubules and forms a fibrillar structure partially linked to the microtubule network. Interacts via its C-terminus with PLK1. Interacts with ODF1 By similarity. Ref.2

Subcellular location

Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Cell projectioncilium. Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole. Cytoplasmcytoskeletonspindle pole. Note: Localized at the microtubule organizing centers in interphase and spindle poles in mitosis. Localized at the distal/subdistal appendages of mother centrioles.

Tissue specificity

Testis-specific (at protein level). Highly expressed in cytoplasm of step 2 round spermatids. Detected in the middle piece and extends to about half the principal piece of the sperm tails. Ref.1

Post-translational modification

Tyrosine phosphorylated By similarity.

Sequence similarities

Belongs to the ODF2 family.

Sequence caution

The sequence AAC08409.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 10 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5BJF6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5BJF6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.
     65-83: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q5BJF6-3)

Also known as: Cenexin 1;

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ
     65-83: Missing.
Isoform 4 (identifier: Q5BJF6-4)

Also known as: Cenexin 1 variant 1;

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ
Isoform 5 (identifier: Q5BJF6-5)

Also known as: Cenexin 1; ODF2/1;

The sequence of this isoform differs from the canonical sequence as follows:
     65-83: Missing.
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.
Note: Major.
Isoform 6 (identifier: Q5BJF6-6)

Also known as: Isoform 3; ODF2/2;

The sequence of this isoform differs from the canonical sequence as follows:
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.
Isoform 7 (identifier: Q5BJF6-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSASSSGGSPR → MGELPTGCRKRRRKRGGAAARARLHPPRRLHGTTLASDFNDFIRRRFWAQPCRSW
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.
Isoform 8 (identifier: Q5BJF6-8)

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSASSSGGSPR → MGRNRYPPACW
     65-83: Missing.
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.
Isoform 9 (identifier: Q5BJF6-9)

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ
     65-140: Missing.
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.
Isoform 10 (identifier: Q5BJF6-10)

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MSASSSGGSP → MADQQGPHQN
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 829829Outer dense fiber protein 2
PRO_0000299455

Regions

Coiled coil144 – 21774 Potential
Coiled coil245 – 423179 Potential
Coiled coil461 – 798338 Potential

Natural variations

Alternative sequence1 – 4747Missing in isoform 2.
VSP_027665
Alternative sequence1 – 4141MSASS…SVTVT → MKDRSSTPPLHVHVDENTPV HVHIKKLPKPSATSSQ in isoform 3, isoform 4 and isoform 9.
VSP_027666
Alternative sequence1 – 1111MSASSSGGSPR → MGELPTGCRKRRRKRGGAAA RARLHPPRRLHGTTLASDFN DFIRRRFWAQPCRSW in isoform 7.
VSP_042071
Alternative sequence1 – 1111MSASSSGGSPR → MGRNRYPPACW in isoform 8.
VSP_042070
Alternative sequence1 – 1010MSASSSGGSP → MADQQGPHQN in isoform 10.
VSP_044946
Alternative sequence65 – 14076Missing in isoform 9.
VSP_042072
Alternative sequence65 – 8319Missing in isoform 2, isoform 3, isoform 5 and isoform 8.
VSP_027667
Alternative sequence638 – 65720IEHQG…QASQK → VRDWQKGSHELTRAGARIPR in isoform 5, isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10.
VSP_027668
Alternative sequence658 – 829172Missing in isoform 5, isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10.
VSP_027669
Natural variant7101T → S.
Corresponds to variant rs16930426 [ dbSNP | Ensembl ].
VAR_034821

Experimental info

Sequence conflict391T → A in AAP83847. Ref.3
Sequence conflict1941I → R in AAP83847. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 12, 2005. Version 1.
Checksum: CF49166AD9003BEB

FASTA82995,401
        10         20         30         40         50         60 
MSASSSGGSP RFPSCGKNGV TSLTQKKVLR APCGAPSVTV TKSHKRGMKG DTVNVRRSVR 

        70         80         90        100        110        120 
VKTKVPWMPP GKSSARPVGC KWENPPHCLE ITPPSSEKLV SVMRLSDLST EDDDSGHCKM 

       130        140        150        160        170        180 
NRYDKKIDSL MNAVGCLKSE VKMQKGERQM AKRFLEERKE ELEEVAHELA ETEHENTVLR 

       190        200        210        220        230        240 
HNIERMKEEK DFTILQKKHL QQEKECLMSK LVEAEMDGAA AAKQVMALKD TIGKLKTEKQ 

       250        260        270        280        290        300 
MTCTDINTLT RQKELLLQKL STFEETNRTL RDLLREQHCK EDSERLMEQQ GALLKRLAEA 

       310        320        330        340        350        360 
DSEKARLLLL LQDKDKEVEE LLQEIQCEKA QAKTASELSK SMESMRGHLQ AQLRSKEAEN 

       370        380        390        400        410        420 
SRLCMQIKNL ERSGNQHKAE VEAIMEQLKE LKQKGDRDKE SLKKAIRAQK ERAEKSEEYA 

       430        440        450        460        470        480 
EQLHVQLADK DLYVAEALST LESWRSRYNQ VVKEKGDLEL EIIVLNDRVT DLVNQQQTLE 

       490        500        510        520        530        540 
EKMREDRDSL VERLHRQTAE YSAFKLENER LKASFAPMED KLNQAHLEVQ QLKASVKNYE 

       550        560        570        580        590        600 
GMIDNYKSQV MKTRLEADEV AAQLERCDKE NKILKDEMNK EIEAARRQFQ SQLADLQQLP 

       610        620        630        640        650        660 
DILKITEAKL AECQDQLQGY ERKNIDLTAI ISDLRSRIEH QGDKLEMARE KHQASQKENK 

       670        680        690        700        710        720 
QLSLKVDELE RKLEATSAQN IEFLQVIAKR EEAIHQSQLR LEEKTRECGT LARQLESAIE 

       730        740        750        760        770        780 
DARRQVEQTK EHALSKERAA QNKILDLETQ LSRTKTELSQ LRRSRDDADR RYQSRLQDLK 

       790        800        810        820 
DRLEQSESTN RSMQNYVQFL KSSYANVFGD GPYSTFLTSS PIRSRSPPA 

« Hide

Isoform 2 [UniParc].

Checksum: 5055A59E4E74DF9C
Show »

FASTA76388,578
Isoform 3 (Cenexin 1) [UniParc].

Checksum: 1321EE3AC5FCF622
Show »

FASTA80593,254
Isoform 4 (Cenexin 1 variant 1) [UniParc].

Checksum: 166CFD3FA9F93215
Show »

FASTA82495,348
Isoform 5 (Cenexin 1) (ODF2/1) [UniParc].

Checksum: B7625F274EDB1EAB
Show »

FASTA63873,339
Isoform 6 (Isoform 3) (ODF2/2) [UniParc].

Checksum: AC80174E5B017689
Show »

FASTA65775,433
Isoform 7 [UniParc].

Checksum: 78681E3A810390B4
Show »

FASTA70180,886
Isoform 8 [UniParc].

Checksum: C7C7CFFF669EC468
Show »

FASTA63873,666
Isoform 9 [UniParc].

Checksum: A8B1A574A75B89E5
Show »

FASTA57666,967
Isoform 10 [UniParc].

Checksum: D01296974EBEA8F5
Show »

FASTA65775,691

References

« Hide 'large scale' references
[1]"Outer dense fibre proteins from human sperm tail: molecular cloning and expression analyses of two cDNA transcripts encoding proteins of approximately 70 kDa."
Petersen C., Fuezesi L., Hoyer-Fender S.
Mol. Hum. Reprod. 5:627-635(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [MRNA] OF 18-829 (ISOFORM 6), TISSUE SPECIFICITY.
Tissue: Testis.
[2]"Requirement of hCenexin for proper mitotic functions of polo-like kinase 1 at the centrosomes."
Soung N.-K., Kang Y.H., Kim K., Kamijo K., Yoon H., Seong Y.S., Kuo Y.-L., Miki T., Kim S.R., Kuriyama R., Giam C.-Z., Ahn C.H., Lee K.S.
Mol. Cell. Biol. 26:8316-8335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), FUNCTION, ALTERNATIVE SPLICING, INTERACTION WITH PLK1.
[3]"Cloning and characterization of the outer dense fiber protein in spermatogenesis."
Xu Z.Y., Huang X.Y., Yin L.L., Xu M., Lu L., Li J.M., Zhou Z.M., Sha J.H.
Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 6).
Tissue: Testis.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 10).
Tissue: Testis.
[5]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Eye and Testis.
[8]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF012549 mRNA. Translation: AAB66337.1.
AF053970 mRNA. Translation: AAC08409.1. Different initiation.
DQ444713 mRNA. Translation: ABE01856.1.
DQ444714 mRNA. Translation: ABE01857.1.
AY319414 mRNA. Translation: AAP83847.1.
AY366499 mRNA. Translation: AAQ73195.1.
AK299303 mRNA. Translation: BAG61316.1.
AK301842 mRNA. Translation: BAG63285.1.
AK302684 mRNA. Translation: BAG63914.1.
AL445287, AL359091 Genomic DNA. Translation: CAH71066.1.
AL445287, AL359091 Genomic DNA. Translation: CAH71067.1.
AL445287, AL359091 Genomic DNA. Translation: CAH71069.1.
AL359091, AL445287 Genomic DNA. Translation: CAI13499.1.
AL359091, AL445287 Genomic DNA. Translation: CAI13500.1.
AL359091, AL445287 Genomic DNA. Translation: CAI13506.1.
CH471090 Genomic DNA. Translation: EAW87791.1.
CH471090 Genomic DNA. Translation: EAW87793.1.
CH471090 Genomic DNA. Translation: EAW87795.1.
BC091500 mRNA. Translation: AAH91500.1.
BC010629 mRNA. Translation: AAH10629.1.
CCDSCCDS56585.1. [Q5BJF6-10]
CCDS56586.1. [Q5BJF6-7]
CCDS56587.1. [Q5BJF6-8]
CCDS56588.1. [Q5BJF6-1]
CCDS56589.1. [Q5BJF6-9]
CCDS56590.1. [Q5BJF6-4]
CCDS6902.1. [Q5BJF6-5]
PIRT03791.
RefSeqNP_001229281.1. NM_001242352.1. [Q5BJF6-4]
NP_001229282.1. NM_001242353.1. [Q5BJF6-1]
NP_001229283.1. NM_001242354.1. [Q5BJF6-9]
NP_002531.3. NM_002540.4. [Q5BJF6-3]
NP_702910.1. NM_153432.1. [Q5BJF6-7]
NP_702911.1. NM_153433.1. [Q5BJF6-1]
NP_702913.1. NM_153435.1.
NP_702914.1. NM_153436.1. [Q5BJF6-10]
NP_702915.1. NM_153437.2. [Q5BJF6-5]
XP_006717189.1. XM_006717126.1. [Q5BJF6-1]
XP_006717190.1. XM_006717127.1. [Q5BJF6-3]
XP_006717191.1. XM_006717128.1. [Q5BJF6-6]
UniGeneHs.129055.

3D structure databases

ProteinModelPortalQ5BJF6.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111010. 7 interactions.
IntActQ5BJF6. 2 interactions.

PTM databases

PhosphoSiteQ5BJF6.

Polymorphism databases

DMDM74736013.

Proteomic databases

MaxQBQ5BJF6.
PaxDbQ5BJF6.
PRIDEQ5BJF6.

Protocols and materials databases

DNASU4957.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000351030; ENSP00000342581; ENSG00000136811. [Q5BJF6-4]
ENST00000372791; ENSP00000361877; ENSG00000136811. [Q5BJF6-5]
ENST00000372807; ENSP00000361893; ENSG00000136811. [Q5BJF6-4]
ENST00000372814; ENSP00000361901; ENSG00000136811. [Q5BJF6-7]
ENST00000393527; ENSP00000377161; ENSG00000136811. [Q5BJF6-3]
ENST00000393533; ENSP00000377166; ENSG00000136811. [Q5BJF6-10]
ENST00000434106; ENSP00000403453; ENSG00000136811. [Q5BJF6-1]
ENST00000444119; ENSP00000394506; ENSG00000136811. [Q5BJF6-3]
ENST00000448249; ENSP00000396687; ENSG00000136811. [Q5BJF6-9]
ENST00000546203; ENSP00000437579; ENSG00000136811. [Q5BJF6-8]
ENST00000604420; ENSP00000473949; ENSG00000136811. [Q5BJF6-1]
GeneID4957.
KEGGhsa:4957.
UCSCuc004bva.3. human. [Q5BJF6-7]
uc004bvb.3. human. [Q5BJF6-3]
uc004bvd.4. human. [Q5BJF6-1]
uc004bve.3. human. [Q5BJF6-5]
uc011maz.2. human.
uc011mbc.2. human. [Q5BJF6-9]
uc011mbe.2. human. [Q5BJF6-4]
uc011mbf.2. human. [Q5BJF6-8]

Organism-specific databases

CTD4957.
GeneCardsGC09P131218.
HGNCHGNC:8114. ODF2.
HPAHPA001874.
MIM602015. gene.
neXtProtNX_Q5BJF6.
PharmGKBPA31902.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG116573.
HOGENOMHOG000246967.
HOVERGENHBG052808.
InParanoidQ5BJF6.
KOK16479.
OMASATINFW.
OrthoDBEOG780RKV.
PhylomeDBQ5BJF6.
TreeFamTF328605.

Enzyme and pathway databases

ReactomeREACT_115566. Cell Cycle.

Gene expression databases

ArrayExpressQ5BJF6.
BgeeQ5BJF6.
CleanExHS_ODF2.
GenevestigatorQ5BJF6.

Family and domain databases

InterProIPR026099. Odf2-rel.
[Graphical view]
PANTHERPTHR23162. PTHR23162. 1 hit.
ProtoNetSearch...

Other

ChiTaRSODF2. human.
GeneWikiODF2.
GenomeRNAi4957.
NextBio19090.
PROQ5BJF6.
SOURCESearch...

Entry information

Entry nameODFP2_HUMAN
AccessionPrimary (citable) accession number: Q5BJF6
Secondary accession number(s): B1AND3 expand/collapse secondary AC list , B4DRK4, B4DX73, B4DZ02, E7EWL2, F5H6J4, O14721, O60631, Q1W2J6, Q6UN26, Q7Z5I6, Q96FN2
Entry history
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: April 12, 2005
Last modified: July 9, 2014
This is version 80 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM