Q5BJF6 (ODFP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 54.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Outer dense fiber protein 2 Alternative name(s): Cenexin Outer dense fiber of sperm tails protein 2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 829 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly. Ref.2 |
| Subunit structure | Self-associates. Associates with microtubules and forms a fibrillar structure partially linked to the microtubule network. Interacts via its C-terminus with PLK1. Interacts with ODF1 By similarity. Ref.2 |
| Subcellular location | Cytoplasm › cytoskeleton › centrosome. Cell projection › cilium. Cytoplasm › cytoskeleton › centrosome › centriole. Cytoplasm › cytoskeleton › spindle pole. Note: Localized at the microtubule organizing centers in interphase and spindle poles in mitosis. Localized at the distal/subdistal appendages of mother centrioles. |
| Tissue specificity | Testis-specific (at protein level). Highly expressed in cytoplasm of step 2 round spermatids. Detected in the middle piece and extends to about half the principal piece of the sperm tails. Ref.1 |
| Post-translational modification | Tyrosine phosphorylated By similarity. |
| Sequence similarities | Belongs to the ODF2 family. |
| Sequence caution | The sequence AAC08409.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5BJF6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5BJF6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-47: Missing. 65-83: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q5BJF6-3) Also known as: Cenexin 1; The sequence of this isoform differs from the canonical sequence as follows: 1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ 65-83: Missing. | ||||||
| Isoform 4 (identifier: Q5BJF6-4) Also known as: Cenexin 1 variant 1; The sequence of this isoform differs from the canonical sequence as follows: 1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ | ||||||
| Isoform 5 (identifier: Q5BJF6-5) Also known as: Cenexin 1; ODF2/1; The sequence of this isoform differs from the canonical sequence as follows: 65-83: Missing. 638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR 658-829: Missing. | ||||||
| Note: Major. | ||||||
| Isoform 6 (identifier: Q5BJF6-6) Also known as: Isoform 3; ODF2/2; The sequence of this isoform differs from the canonical sequence as follows: 638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR 658-829: Missing. | ||||||
| Isoform 7 (identifier: Q5BJF6-7) The sequence of this isoform differs from the canonical sequence as follows: 1-11: MSASSSGGSPR → MGELPTGCRKRRRKRGGAAARARLHPPRRLHGTTLASDFNDFIRRRFWAQPCRSW 638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR 658-829: Missing. | ||||||
| Isoform 8 (identifier: Q5BJF6-8) The sequence of this isoform differs from the canonical sequence as follows: 1-11: MSASSSGGSPR → MGRNRYPPACW 65-83: Missing. 638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR 658-829: Missing. | ||||||
| Isoform 9 (identifier: Q5BJF6-9) The sequence of this isoform differs from the canonical sequence as follows: 1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ 65-140: Missing. 638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR 658-829: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 829 | 829 | Outer dense fiber protein 2 | PRO_0000299455 | |||||
Regions | |||||||||
| Coiled coil | 144 – 217 | 74 | Potential | ||||||
| Coiled coil | 245 – 423 | 179 | Potential | ||||||
| Coiled coil | 461 – 798 | 338 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 47 | 47 | Missing in isoform 2. | VSP_027665 | |||||
| Alternative sequence | 1 – 41 | 41 | MSASS…SVTVT → MKDRSSTPPLHVHVDENTPV HVHIKKLPKPSATSSQ in isoform 3, isoform 4 and isoform 9. | VSP_027666 | |||||
| Alternative sequence | 1 – 11 | 11 | MSASSSGGSPR → MGELPTGCRKRRRKRGGAAA RARLHPPRRLHGTTLASDFN DFIRRRFWAQPCRSW in isoform 7. | VSP_042071 | |||||
| Alternative sequence | 1 – 11 | 11 | MSASSSGGSPR → MGRNRYPPACW in isoform 8. | VSP_042070 | |||||
| Alternative sequence | 65 – 140 | 76 | Missing in isoform 9. | VSP_042072 | |||||
| Alternative sequence | 65 – 83 | 19 | Missing in isoform 2, isoform 3, isoform 5 and isoform 8. | VSP_027667 | |||||
| Alternative sequence | 638 – 657 | 20 | IEHQG…QASQK → VRDWQKGSHELTRAGARIPR in isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9. | VSP_027668 | |||||
| Alternative sequence | 658 – 829 | 172 | Missing in isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9. | VSP_027669 | |||||
| Natural variant | 710 | 1 | T → S. Corresponds to variant rs16930426 [ dbSNP | Ensembl ]. | VAR_034821 | |||||
Experimental info | |||||||||
| Sequence conflict | 39 | 1 | T → A in AAP83847. Ref.3 | ||||||
| Sequence conflict | 194 | 1 | I → R in AAP83847. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Outer dense fibre proteins from human sperm tail: molecular cloning and expression analyses of two cDNA transcripts encoding proteins of approximately 70 kDa." Petersen C., Fuezesi L., Hoyer-Fender S. Mol. Hum. Reprod. 5:627-635(1999) [PubMed: 10381817] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [MRNA] OF 18-829 (ISOFORM 6), TISSUE SPECIFICITY. Tissue: Testis. |
| [2] | "Requirement of hCenexin for proper mitotic functions of polo-like kinase 1 at the centrosomes." Soung N.-K., Kang Y.H., Kim K., Kamijo K., Yoon H., Seong Y.S., Kuo Y.-L., Miki T., Kim S.R., Kuriyama R., Giam C.-Z., Ahn C.H., Lee K.S. Mol. Cell. Biol. 26:8316-8335(2006) [PubMed: 16966375] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), FUNCTION, ALTERNATIVE SPLICING, INTERACTION WITH PLK1. |
| [3] | "Cloning and characterization of the outer dense fiber protein in spermatogenesis." Xu Z.Y., Huang X.Y., Yin L.L., Xu M., Lu L., Li J.M., Zhou Z.M., Sha J.H. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 6). Tissue: Testis. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4). Tissue: Testis. |
| [5] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed: 15164053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Eye and Testis. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF012549 mRNA. Translation: AAB66337.1. AF053970 mRNA. Translation: AAC08409.1. Different initiation. DQ444713 mRNA. Translation: ABE01856.1. DQ444714 mRNA. Translation: ABE01857.1. AY319414 mRNA. Translation: AAP83847.1. AY366499 mRNA. Translation: AAQ73195.1. AK302684 mRNA. Translation: BAG63914.1. AK299303 mRNA. Translation: BAG61316.1. AL445287, AL359091 Genomic DNA. Translation: CAH71066.1. AL445287, AL359091 Genomic DNA. Translation: CAH71067.1. AL445287, AL359091 Genomic DNA. Translation: CAH71069.1. AL359091, AL445287 Genomic DNA. Translation: CAI13499.1. AL359091, AL445287 Genomic DNA. Translation: CAI13500.1. AL359091, AL445287 Genomic DNA. Translation: CAI13506.1. CH471090 Genomic DNA. Translation: EAW87791.1. CH471090 Genomic DNA. Translation: EAW87793.1. CH471090 Genomic DNA. Translation: EAW87795.1. BC091500 mRNA. Translation: AAH91500.1. BC010629 mRNA. Translation: AAH10629.1. |
| IPI | IPI00001758. IPI00171245. IPI00515017. IPI00640027. IPI00642221. IPI00855929. IPI00855984. IPI01011877. |
| PIR | T03791. |
| RefSeq | NP_001229281.1. NM_001242352.1. NP_001229282.1. NM_001242353.1. NP_001229283.1. NM_001242354.1. NP_702910.1. NM_153432.1. NP_702911.1. NM_153433.1. NP_702913.1. NM_153435.1. NP_702915.1. NM_153437.2. |
| UniGene | Hs.129055. |
3D structure databases | |
| ProteinModelPortal | Q5BJF6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q5BJF6. |
PTM databases | |
| PhosphoSite | Q5BJF6. |
Polymorphism databases | |
| DMDM | 74736013. |
Proteomic databases | |
| PRIDE | Q5BJF6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000372796; ENSP00000361882; ENSG00000136811. ENST00000372814; ENSP00000361901; ENSG00000136811. ENST00000448249; ENSP00000396687; ENSG00000136811. ENST00000546203; ENSP00000437579; ENSG00000136811. |
| GeneID | 4957. |
| KEGG | hsa:4957. |
| UCSC | uc004bva.1. human. uc004bvb.1. human. uc004bvd.2. human. uc004bve.1. human. uc004bvf.1. human. |
Organism-specific databases | |
| CTD | 4957. |
| GeneCards | GC09P131218. |
| HGNC | HGNC:8114. ODF2. |
| HPA | HPA001874. |
| MIM | 602015. gene. |
| neXtProt | NX_Q5BJF6. |
| PharmGKB | PA31902. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG052808. |
| InParanoid | Q5BJF6. |
| OMA | GDSPYTT. |
| PhylomeDB | Q5BJF6. |
Enzyme and pathway databases | |
| Reactome | REACT_152. Cell Cycle, Mitotic. |
Gene expression databases | |
| ArrayExpress | Q5BJF6. |
| Bgee | Q5BJF6. |
| CleanEx | HS_ODF2. |
| Genevestigator | Q5BJF6. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 19090. |
| SOURCE | Search... |
Entry information
| Entry name | ODFP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5BJF6 Secondary accession number(s): B1AND3 Q96FN2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with