Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5BJF6

- ODFP2_HUMAN

UniProt

Q5BJF6 - ODFP2_HUMAN

Protein

Outer dense fiber protein 2

Gene

ODF2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 82 (01 Oct 2014)
      Sequence version 1 (12 Apr 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly.1 Publication

    GO - Molecular functioni

    1. protein binding Source: UniProtKB
    2. structural molecule activity Source: ProtInc

    GO - Biological processi

    1. G2/M transition of mitotic cell cycle Source: Reactome
    2. mitotic cell cycle Source: Reactome
    3. multicellular organismal development Source: UniProtKB-KW
    4. spermatid development Source: Ensembl

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, Spermatogenesis

    Enzyme and pathway databases

    ReactomeiREACT_15296. Recruitment of mitotic centrosome proteins and complexes.
    REACT_15364. Loss of Nlp from mitotic centrosomes.
    REACT_15451. Loss of proteins required for interphase microtubule organization from the centrosome.
    REACT_160315. Regulation of PLK1 Activity at G2/M Transition.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Outer dense fiber protein 2
    Alternative name(s):
    Cenexin
    Outer dense fiber of sperm tails protein 2
    Gene namesi
    Name:ODF2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:8114. ODF2.

    Subcellular locationi

    Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Cell projectioncilium. Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole. Cytoplasmcytoskeletonspindle pole
    Note: Localized at the microtubule organizing centers in interphase and spindle poles in mitosis. Localized at the distal/subdistal appendages of mother centrioles.

    GO - Cellular componenti

    1. centriole Source: MGI
    2. centrosome Source: UniProtKB
    3. cytosol Source: Reactome
    4. microtubule Source: UniProtKB-KW
    5. nucleus Source: UniProt
    6. outer dense fiber Source: Ensembl
    7. spindle pole Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell projection, Cilium, Cytoplasm, Cytoskeleton, Microtubule

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31902.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 829829Outer dense fiber protein 2PRO_0000299455Add
    BLAST

    Post-translational modificationi

    Tyrosine phosphorylated.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ5BJF6.
    PaxDbiQ5BJF6.
    PRIDEiQ5BJF6.

    PTM databases

    PhosphoSiteiQ5BJF6.

    Expressioni

    Tissue specificityi

    Testis-specific (at protein level). Highly expressed in cytoplasm of step 2 round spermatids. Detected in the middle piece and extends to about half the principal piece of the sperm tails.1 Publication

    Gene expression databases

    ArrayExpressiQ5BJF6.
    BgeeiQ5BJF6.
    CleanExiHS_ODF2.
    GenevestigatoriQ5BJF6.

    Organism-specific databases

    HPAiHPA001874.

    Interactioni

    Subunit structurei

    Self-associates. Associates with microtubules and forms a fibrillar structure partially linked to the microtubule network. Interacts via its C-terminus with PLK1. Interacts with ODF1 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi111010. 7 interactions.
    IntActiQ5BJF6. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5BJF6.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili144 – 21774Sequence AnalysisAdd
    BLAST
    Coiled coili245 – 423179Sequence AnalysisAdd
    BLAST
    Coiled coili461 – 798338Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the ODF2 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG116573.
    HOGENOMiHOG000246967.
    HOVERGENiHBG052808.
    InParanoidiQ5BJF6.
    KOiK16479.
    OMAiSATINFW.
    OrthoDBiEOG780RKV.
    PhylomeDBiQ5BJF6.
    TreeFamiTF328605.

    Family and domain databases

    InterProiIPR026099. Odf2-rel.
    [Graphical view]
    PANTHERiPTHR23162. PTHR23162. 1 hit.

    Sequences (10)i

    Sequence statusi: Complete.

    This entry describes 10 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5BJF6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSASSSGGSP RFPSCGKNGV TSLTQKKVLR APCGAPSVTV TKSHKRGMKG    50
    DTVNVRRSVR VKTKVPWMPP GKSSARPVGC KWENPPHCLE ITPPSSEKLV 100
    SVMRLSDLST EDDDSGHCKM NRYDKKIDSL MNAVGCLKSE VKMQKGERQM 150
    AKRFLEERKE ELEEVAHELA ETEHENTVLR HNIERMKEEK DFTILQKKHL 200
    QQEKECLMSK LVEAEMDGAA AAKQVMALKD TIGKLKTEKQ MTCTDINTLT 250
    RQKELLLQKL STFEETNRTL RDLLREQHCK EDSERLMEQQ GALLKRLAEA 300
    DSEKARLLLL LQDKDKEVEE LLQEIQCEKA QAKTASELSK SMESMRGHLQ 350
    AQLRSKEAEN SRLCMQIKNL ERSGNQHKAE VEAIMEQLKE LKQKGDRDKE 400
    SLKKAIRAQK ERAEKSEEYA EQLHVQLADK DLYVAEALST LESWRSRYNQ 450
    VVKEKGDLEL EIIVLNDRVT DLVNQQQTLE EKMREDRDSL VERLHRQTAE 500
    YSAFKLENER LKASFAPMED KLNQAHLEVQ QLKASVKNYE GMIDNYKSQV 550
    MKTRLEADEV AAQLERCDKE NKILKDEMNK EIEAARRQFQ SQLADLQQLP 600
    DILKITEAKL AECQDQLQGY ERKNIDLTAI ISDLRSRIEH QGDKLEMARE 650
    KHQASQKENK QLSLKVDELE RKLEATSAQN IEFLQVIAKR EEAIHQSQLR 700
    LEEKTRECGT LARQLESAIE DARRQVEQTK EHALSKERAA QNKILDLETQ 750
    LSRTKTELSQ LRRSRDDADR RYQSRLQDLK DRLEQSESTN RSMQNYVQFL 800
    KSSYANVFGD GPYSTFLTSS PIRSRSPPA 829
    Length:829
    Mass (Da):95,401
    Last modified:April 12, 2005 - v1
    Checksum:iCF49166AD9003BEB
    GO
    Isoform 2 (identifier: Q5BJF6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-47: Missing.
         65-83: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:763
    Mass (Da):88,578
    Checksum:i5055A59E4E74DF9C
    GO
    Isoform 3 (identifier: Q5BJF6-3) [UniParc]FASTAAdd to Basket

    Also known as: Cenexin 1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ
         65-83: Missing.

    Show »
    Length:805
    Mass (Da):93,254
    Checksum:i1321EE3AC5FCF622
    GO
    Isoform 4 (identifier: Q5BJF6-4) [UniParc]FASTAAdd to Basket

    Also known as: Cenexin 1 variant 1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ

    Show »
    Length:824
    Mass (Da):95,348
    Checksum:i166CFD3FA9F93215
    GO
    Isoform 5 (identifier: Q5BJF6-5) [UniParc]FASTAAdd to Basket

    Also known as: Cenexin 1, ODF2/1

    The sequence of this isoform differs from the canonical sequence as follows:
         65-83: Missing.
         638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
         658-829: Missing.

    Note: Major.

    Show »
    Length:638
    Mass (Da):73,339
    Checksum:iB7625F274EDB1EAB
    GO
    Isoform 6 (identifier: Q5BJF6-6) [UniParc]FASTAAdd to Basket

    Also known as: Isoform 3, ODF2/2

    The sequence of this isoform differs from the canonical sequence as follows:
         638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
         658-829: Missing.

    Show »
    Length:657
    Mass (Da):75,433
    Checksum:iAC80174E5B017689
    GO
    Isoform 7 (identifier: Q5BJF6-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MSASSSGGSPR → MGELPTGCRKRRRKRGGAAARARLHPPRRLHGTTLASDFNDFIRRRFWAQPCRSW
         638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
         658-829: Missing.

    Show »
    Length:701
    Mass (Da):80,886
    Checksum:i78681E3A810390B4
    GO
    Isoform 8 (identifier: Q5BJF6-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MSASSSGGSPR → MGRNRYPPACW
         65-83: Missing.
         638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
         658-829: Missing.

    Show »
    Length:638
    Mass (Da):73,666
    Checksum:iC7C7CFFF669EC468
    GO
    Isoform 9 (identifier: Q5BJF6-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ
         65-140: Missing.
         638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
         658-829: Missing.

    Show »
    Length:576
    Mass (Da):66,967
    Checksum:iA8B1A574A75B89E5
    GO
    Isoform 10 (identifier: Q5BJF6-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-10: MSASSSGGSP → MADQQGPHQN
         638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
         658-829: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:657
    Mass (Da):75,691
    Checksum:iD01296974EBEA8F5
    GO

    Sequence cautioni

    The sequence AAC08409.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti39 – 391T → A in AAP83847. 1 PublicationCurated
    Sequence conflicti194 – 1941I → R in AAP83847. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti710 – 7101T → S.
    Corresponds to variant rs16930426 [ dbSNP | Ensembl ].
    VAR_034821

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4747Missing in isoform 2. 1 PublicationVSP_027665Add
    BLAST
    Alternative sequencei1 – 4141MSASS…SVTVT → MKDRSSTPPLHVHVDENTPV HVHIKKLPKPSATSSQ in isoform 3, isoform 4 and isoform 9. 3 PublicationsVSP_027666Add
    BLAST
    Alternative sequencei1 – 1111MSASSSGGSPR → MGELPTGCRKRRRKRGGAAA RARLHPPRRLHGTTLASDFN DFIRRRFWAQPCRSW in isoform 7. CuratedVSP_042071Add
    BLAST
    Alternative sequencei1 – 1111MSASSSGGSPR → MGRNRYPPACW in isoform 8. CuratedVSP_042070Add
    BLAST
    Alternative sequencei1 – 1010MSASSSGGSP → MADQQGPHQN in isoform 10. 1 PublicationVSP_044946
    Alternative sequencei65 – 14076Missing in isoform 9. CuratedVSP_042072Add
    BLAST
    Alternative sequencei65 – 8319Missing in isoform 2, isoform 3, isoform 5 and isoform 8. 4 PublicationsVSP_027667Add
    BLAST
    Alternative sequencei638 – 65720IEHQG…QASQK → VRDWQKGSHELTRAGARIPR in isoform 5, isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10. 3 PublicationsVSP_027668Add
    BLAST
    Alternative sequencei658 – 829172Missing in isoform 5, isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10. 3 PublicationsVSP_027669Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF012549 mRNA. Translation: AAB66337.1.
    AF053970 mRNA. Translation: AAC08409.1. Different initiation.
    DQ444713 mRNA. Translation: ABE01856.1.
    DQ444714 mRNA. Translation: ABE01857.1.
    AY319414 mRNA. Translation: AAP83847.1.
    AY366499 mRNA. Translation: AAQ73195.1.
    AK299303 mRNA. Translation: BAG61316.1.
    AK301842 mRNA. Translation: BAG63285.1.
    AK302684 mRNA. Translation: BAG63914.1.
    AL445287, AL359091 Genomic DNA. Translation: CAH71066.1.
    AL445287, AL359091 Genomic DNA. Translation: CAH71067.1.
    AL445287, AL359091 Genomic DNA. Translation: CAH71069.1.
    AL359091, AL445287 Genomic DNA. Translation: CAI13499.1.
    AL359091, AL445287 Genomic DNA. Translation: CAI13500.1.
    AL359091, AL445287 Genomic DNA. Translation: CAI13506.1.
    CH471090 Genomic DNA. Translation: EAW87791.1.
    CH471090 Genomic DNA. Translation: EAW87793.1.
    CH471090 Genomic DNA. Translation: EAW87795.1.
    BC091500 mRNA. Translation: AAH91500.1.
    BC010629 mRNA. Translation: AAH10629.1.
    CCDSiCCDS56585.1. [Q5BJF6-10]
    CCDS56586.1. [Q5BJF6-7]
    CCDS56587.1. [Q5BJF6-8]
    CCDS56588.1. [Q5BJF6-1]
    CCDS56589.1. [Q5BJF6-9]
    CCDS56590.1. [Q5BJF6-4]
    CCDS6902.1. [Q5BJF6-5]
    PIRiT03791.
    RefSeqiNP_001229281.1. NM_001242352.1. [Q5BJF6-4]
    NP_001229282.1. NM_001242353.1. [Q5BJF6-1]
    NP_001229283.1. NM_001242354.1. [Q5BJF6-9]
    NP_002531.3. NM_002540.4. [Q5BJF6-3]
    NP_702910.1. NM_153432.1. [Q5BJF6-7]
    NP_702911.1. NM_153433.1. [Q5BJF6-1]
    NP_702913.1. NM_153435.1.
    NP_702914.1. NM_153436.1. [Q5BJF6-10]
    NP_702915.1. NM_153437.2. [Q5BJF6-5]
    XP_006717189.1. XM_006717126.1. [Q5BJF6-1]
    XP_006717190.1. XM_006717127.1. [Q5BJF6-3]
    XP_006717191.1. XM_006717128.1. [Q5BJF6-6]
    UniGeneiHs.129055.

    Genome annotation databases

    EnsembliENST00000351030; ENSP00000342581; ENSG00000136811. [Q5BJF6-4]
    ENST00000372791; ENSP00000361877; ENSG00000136811. [Q5BJF6-5]
    ENST00000372807; ENSP00000361893; ENSG00000136811. [Q5BJF6-4]
    ENST00000372814; ENSP00000361901; ENSG00000136811. [Q5BJF6-7]
    ENST00000393527; ENSP00000377161; ENSG00000136811. [Q5BJF6-3]
    ENST00000393533; ENSP00000377166; ENSG00000136811. [Q5BJF6-10]
    ENST00000434106; ENSP00000403453; ENSG00000136811. [Q5BJF6-1]
    ENST00000444119; ENSP00000394506; ENSG00000136811. [Q5BJF6-3]
    ENST00000448249; ENSP00000396687; ENSG00000136811. [Q5BJF6-9]
    ENST00000546203; ENSP00000437579; ENSG00000136811. [Q5BJF6-8]
    ENST00000604420; ENSP00000473949; ENSG00000136811. [Q5BJF6-1]
    GeneIDi4957.
    KEGGihsa:4957.
    UCSCiuc004bva.3. human. [Q5BJF6-7]
    uc004bvb.3. human. [Q5BJF6-3]
    uc004bvd.4. human. [Q5BJF6-1]
    uc004bve.3. human. [Q5BJF6-5]
    uc011maz.2. human.
    uc011mbc.2. human. [Q5BJF6-9]
    uc011mbe.2. human. [Q5BJF6-4]
    uc011mbf.2. human. [Q5BJF6-8]

    Polymorphism databases

    DMDMi74736013.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF012549 mRNA. Translation: AAB66337.1 .
    AF053970 mRNA. Translation: AAC08409.1 . Different initiation.
    DQ444713 mRNA. Translation: ABE01856.1 .
    DQ444714 mRNA. Translation: ABE01857.1 .
    AY319414 mRNA. Translation: AAP83847.1 .
    AY366499 mRNA. Translation: AAQ73195.1 .
    AK299303 mRNA. Translation: BAG61316.1 .
    AK301842 mRNA. Translation: BAG63285.1 .
    AK302684 mRNA. Translation: BAG63914.1 .
    AL445287 , AL359091 Genomic DNA. Translation: CAH71066.1 .
    AL445287 , AL359091 Genomic DNA. Translation: CAH71067.1 .
    AL445287 , AL359091 Genomic DNA. Translation: CAH71069.1 .
    AL359091 , AL445287 Genomic DNA. Translation: CAI13499.1 .
    AL359091 , AL445287 Genomic DNA. Translation: CAI13500.1 .
    AL359091 , AL445287 Genomic DNA. Translation: CAI13506.1 .
    CH471090 Genomic DNA. Translation: EAW87791.1 .
    CH471090 Genomic DNA. Translation: EAW87793.1 .
    CH471090 Genomic DNA. Translation: EAW87795.1 .
    BC091500 mRNA. Translation: AAH91500.1 .
    BC010629 mRNA. Translation: AAH10629.1 .
    CCDSi CCDS56585.1. [Q5BJF6-10 ]
    CCDS56586.1. [Q5BJF6-7 ]
    CCDS56587.1. [Q5BJF6-8 ]
    CCDS56588.1. [Q5BJF6-1 ]
    CCDS56589.1. [Q5BJF6-9 ]
    CCDS56590.1. [Q5BJF6-4 ]
    CCDS6902.1. [Q5BJF6-5 ]
    PIRi T03791.
    RefSeqi NP_001229281.1. NM_001242352.1. [Q5BJF6-4 ]
    NP_001229282.1. NM_001242353.1. [Q5BJF6-1 ]
    NP_001229283.1. NM_001242354.1. [Q5BJF6-9 ]
    NP_002531.3. NM_002540.4. [Q5BJF6-3 ]
    NP_702910.1. NM_153432.1. [Q5BJF6-7 ]
    NP_702911.1. NM_153433.1. [Q5BJF6-1 ]
    NP_702913.1. NM_153435.1.
    NP_702914.1. NM_153436.1. [Q5BJF6-10 ]
    NP_702915.1. NM_153437.2. [Q5BJF6-5 ]
    XP_006717189.1. XM_006717126.1. [Q5BJF6-1 ]
    XP_006717190.1. XM_006717127.1. [Q5BJF6-3 ]
    XP_006717191.1. XM_006717128.1. [Q5BJF6-6 ]
    UniGenei Hs.129055.

    3D structure databases

    ProteinModelPortali Q5BJF6.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111010. 7 interactions.
    IntActi Q5BJF6. 3 interactions.

    PTM databases

    PhosphoSitei Q5BJF6.

    Polymorphism databases

    DMDMi 74736013.

    Proteomic databases

    MaxQBi Q5BJF6.
    PaxDbi Q5BJF6.
    PRIDEi Q5BJF6.

    Protocols and materials databases

    DNASUi 4957.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000351030 ; ENSP00000342581 ; ENSG00000136811 . [Q5BJF6-4 ]
    ENST00000372791 ; ENSP00000361877 ; ENSG00000136811 . [Q5BJF6-5 ]
    ENST00000372807 ; ENSP00000361893 ; ENSG00000136811 . [Q5BJF6-4 ]
    ENST00000372814 ; ENSP00000361901 ; ENSG00000136811 . [Q5BJF6-7 ]
    ENST00000393527 ; ENSP00000377161 ; ENSG00000136811 . [Q5BJF6-3 ]
    ENST00000393533 ; ENSP00000377166 ; ENSG00000136811 . [Q5BJF6-10 ]
    ENST00000434106 ; ENSP00000403453 ; ENSG00000136811 . [Q5BJF6-1 ]
    ENST00000444119 ; ENSP00000394506 ; ENSG00000136811 . [Q5BJF6-3 ]
    ENST00000448249 ; ENSP00000396687 ; ENSG00000136811 . [Q5BJF6-9 ]
    ENST00000546203 ; ENSP00000437579 ; ENSG00000136811 . [Q5BJF6-8 ]
    ENST00000604420 ; ENSP00000473949 ; ENSG00000136811 . [Q5BJF6-1 ]
    GeneIDi 4957.
    KEGGi hsa:4957.
    UCSCi uc004bva.3. human. [Q5BJF6-7 ]
    uc004bvb.3. human. [Q5BJF6-3 ]
    uc004bvd.4. human. [Q5BJF6-1 ]
    uc004bve.3. human. [Q5BJF6-5 ]
    uc011maz.2. human.
    uc011mbc.2. human. [Q5BJF6-9 ]
    uc011mbe.2. human. [Q5BJF6-4 ]
    uc011mbf.2. human. [Q5BJF6-8 ]

    Organism-specific databases

    CTDi 4957.
    GeneCardsi GC09P131218.
    HGNCi HGNC:8114. ODF2.
    HPAi HPA001874.
    MIMi 602015. gene.
    neXtProti NX_Q5BJF6.
    PharmGKBi PA31902.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG116573.
    HOGENOMi HOG000246967.
    HOVERGENi HBG052808.
    InParanoidi Q5BJF6.
    KOi K16479.
    OMAi SATINFW.
    OrthoDBi EOG780RKV.
    PhylomeDBi Q5BJF6.
    TreeFami TF328605.

    Enzyme and pathway databases

    Reactomei REACT_15296. Recruitment of mitotic centrosome proteins and complexes.
    REACT_15364. Loss of Nlp from mitotic centrosomes.
    REACT_15451. Loss of proteins required for interphase microtubule organization from the centrosome.
    REACT_160315. Regulation of PLK1 Activity at G2/M Transition.

    Miscellaneous databases

    ChiTaRSi ODF2. human.
    GeneWikii ODF2.
    GenomeRNAii 4957.
    NextBioi 19090.
    PROi Q5BJF6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q5BJF6.
    Bgeei Q5BJF6.
    CleanExi HS_ODF2.
    Genevestigatori Q5BJF6.

    Family and domain databases

    InterProi IPR026099. Odf2-rel.
    [Graphical view ]
    PANTHERi PTHR23162. PTHR23162. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Outer dense fibre proteins from human sperm tail: molecular cloning and expression analyses of two cDNA transcripts encoding proteins of approximately 70 kDa."
      Petersen C., Fuezesi L., Hoyer-Fender S.
      Mol. Hum. Reprod. 5:627-635(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [MRNA] OF 18-829 (ISOFORM 6), TISSUE SPECIFICITY.
      Tissue: Testis.
    2. "Requirement of hCenexin for proper mitotic functions of polo-like kinase 1 at the centrosomes."
      Soung N.-K., Kang Y.H., Kim K., Kamijo K., Yoon H., Seong Y.S., Kuo Y.-L., Miki T., Kim S.R., Kuriyama R., Giam C.-Z., Ahn C.H., Lee K.S.
      Mol. Cell. Biol. 26:8316-8335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), FUNCTION, ALTERNATIVE SPLICING, INTERACTION WITH PLK1.
    3. "Cloning and characterization of the outer dense fiber protein in spermatogenesis."
      Xu Z.Y., Huang X.Y., Yin L.L., Xu M., Lu L., Li J.M., Zhou Z.M., Sha J.H.
      Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 6).
      Tissue: Testis.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 10).
      Tissue: Testis.
    5. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Eye and Testis.
    8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.

    Entry informationi

    Entry nameiODFP2_HUMAN
    AccessioniPrimary (citable) accession number: Q5BJF6
    Secondary accession number(s): B1AND3
    , B4DRK4, B4DX73, B4DZ02, E7EWL2, F5H6J4, O14721, O60631, Q1W2J6, Q6UN26, Q7Z5I6, Q96FN2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 11, 2007
    Last sequence update: April 12, 2005
    Last modified: October 1, 2014
    This is version 82 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3