ID TIM9_CANAL Reviewed; 87 AA. AC Q59R24; A0A1D8PRE3; Q3MNZ4; DT 21-MAR-2006, integrated into UniProtKB/Swiss-Prot. DT 15-MAR-2017, sequence version 2. DT 22-FEB-2023, entry version 102. DE RecName: Full=Mitochondrial import inner membrane translocase subunit TIM9; GN Name=TIM9; OrderedLocusNames=CAALFM_C703630CA; GN ORFNames=CaJ7.0415, CaO19.13988, CaO19.6696; OS Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast). OC Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; OC Saccharomycetales; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. OX NCBI_TaxID=237561; RN [1] RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=SC5314 / ATCC MYA-2876; RX PubMed=15937140; DOI=10.1534/genetics.104.034652; RA Chibana H., Oka N., Nakayama H., Aoyama T., Magee B.B., Magee P.T., RA Mikami Y.; RT "Sequence finishing and gene mapping for Candida albicans chromosome 7 and RT syntenic analysis against the Saccharomyces cerevisiae genome."; RL Genetics 170:1525-1537(2005). RN [2] RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=SC5314 / ATCC MYA-2876; RX PubMed=15123810; DOI=10.1073/pnas.0401648101; RA Jones T., Federspiel N.A., Chibana H., Dungan J., Kalman S., Magee B.B., RA Newport G., Thorstenson Y.R., Agabian N., Magee P.T., Davis R.W., RA Scherer S.; RT "The diploid genome sequence of Candida albicans."; RL Proc. Natl. Acad. Sci. U.S.A. 101:7329-7334(2004). RN [3] RP GENOME REANNOTATION. RC STRAIN=SC5314 / ATCC MYA-2876; RX PubMed=17419877; DOI=10.1186/gb-2007-8-4-r52; RA van het Hoog M., Rast T.J., Martchenko M., Grindle S., Dignard D., RA Hogues H., Cuomo C., Berriman M., Scherer S., Magee B.B., Whiteway M., RA Chibana H., Nantel A., Magee P.T.; RT "Assembly of the Candida albicans genome into sixteen supercontigs aligned RT on the eight chromosomes."; RL Genome Biol. 8:RESEARCH52.1-RESEARCH52.12(2007). RN [4] RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND GENOME REANNOTATION. RC STRAIN=SC5314 / ATCC MYA-2876; RX PubMed=24025428; DOI=10.1186/gb-2013-14-9-r97; RA Muzzey D., Schwartz K., Weissman J.S., Sherlock G.; RT "Assembly of a phased diploid Candida albicans genome facilitates allele- RT specific measurements and provides a simple model for repeat and indel RT structure."; RL Genome Biol. 14:RESEARCH97.1-RESEARCH97.14(2013). CC -!- FUNCTION: Mitochondrial intermembrane chaperone that participates in CC the import and insertion of multi-pass transmembrane proteins into the CC mitochondrial inner membrane. Also required for the transfer of beta- CC barrel precursors from the TOM complex to the sorting and assembly CC machinery (SAM complex) of the outer membrane. Acts as a chaperone-like CC protein that protects the hydrophobic precursors from aggregation and CC guide them through the mitochondrial intermembrane space (By CC similarity). {ECO:0000250}. CC -!- SUBUNIT: Heterohexamer; composed of 3 copies of TIM9 and 3 copies of CC TIM10, named soluble 70 kDa complex. Associates with the TIM22 complex, CC whose core is composed of TIM22 and TIM54. Interacts with the CC transmembrane regions of multi-pass transmembrane proteins in transit CC (By similarity). {ECO:0000250}. CC -!- SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000250}; CC Peripheral membrane protein {ECO:0000250}; Intermembrane side CC {ECO:0000250}. CC -!- DOMAIN: The twin CX3C motif contains 4 conserved Cys residues that form CC 2 disulfide bonds in the mitochondrial intermembrane space. However, CC during the transit of TIM9 from cytoplasm into mitochondrion, the Cys CC residues probably coordinate zinc, thereby preventing folding and CC allowing its transfer across mitochondrial outer membrane (By CC similarity). {ECO:0000250}. CC -!- SIMILARITY: Belongs to the small Tim family. {ECO:0000305}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; AP006852; BAE44866.1; -; Genomic_DNA. DR EMBL; CP017629; AOW30705.1; -; Genomic_DNA. DR RefSeq; XP_019331040.1; XM_019475495.1. DR AlphaFoldDB; Q59R24; -. DR SMR; Q59R24; -. DR STRING; 237561.Q59R24; -. DR EnsemblFungi; C7_03630C_A-T; C7_03630C_A-T-p1; C7_03630C_A. DR GeneID; 3646243; -. DR KEGG; cal:CAALFM_C703630CA; -. DR CGD; CAL0000177007; TIM9. DR VEuPathDB; FungiDB:C7_03630C_A; -. DR eggNOG; KOG3479; Eukaryota. DR HOGENOM; CLU_141397_3_0_1; -. DR InParanoid; Q59R24; -. DR OMA; QDFLRMY; -. DR OrthoDB; 8465at2759; -. DR Proteomes; UP000000559; Chromosome 7. DR GO; GO:0042719; C:mitochondrial intermembrane space protein transporter complex; IEA:EnsemblFungi. DR GO; GO:0042721; C:TIM22 mitochondrial import inner membrane insertion complex; IEA:EnsemblFungi. DR GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW. DR GO; GO:0140318; F:protein transporter activity; IEA:EnsemblFungi. DR GO; GO:0051082; F:unfolded protein binding; IEA:EnsemblFungi. DR GO; GO:0045039; P:protein insertion into mitochondrial inner membrane; IEA:EnsemblFungi. DR Gene3D; 1.10.287.810; Mitochondrial import inner membrane translocase subunit tim13 like domains; 1. DR InterPro; IPR004217; Tim10-like. DR InterPro; IPR035427; Tim10-like_dom_sf. DR PANTHER; PTHR13172:SF5; MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM9; 1. DR PANTHER; PTHR13172; MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM9B; 1. DR Pfam; PF02953; zf-Tim10_DDP; 1. DR SUPFAM; SSF144122; Tim10-like; 1. PE 3: Inferred from homology; KW Chaperone; Disulfide bond; Membrane; Metal-binding; Mitochondrion; KW Mitochondrion inner membrane; Protein transport; Reference proteome; KW Translocation; Transport; Zinc. FT CHAIN 1..87 FT /note="Mitochondrial import inner membrane translocase FT subunit TIM9" FT /id="PRO_0000228041" FT MOTIF 35..59 FT /note="Twin CX3C motif" FT DISULFID 35..59 FT /evidence="ECO:0000250" FT DISULFID 39..55 FT /evidence="ECO:0000250" FT CONFLICT 78..87 FT /note="NALLMQQGPK -> KYVDLSRVTNGNMPLMIIIIYHQIILTNKLILL (in FT Ref. 1; BAE44866)" FT /evidence="ECO:0000305" SQ SEQUENCE 87 AA; 10202 MW; 5E78FE30BDA92055 CRC64; MDQLNVKEQQ EFQQIVEQKQ MKDFMNLYSN LVSRCFDDCV NDFTSNSLTS KETSCIAKCS EKFLKHSERV GQRFQEQNAL LMQQGPK //